Align Ornithine aminotransferase 1; OAT 1; EC 2.6.1.13; Ornithine--oxo-acid aminotransferase 1 (uncharacterized)
to candidate AO353_03025 AO353_03025 acetylornithine aminotransferase
Query= curated2:Q4A0N2 (394 letters) >FitnessBrowser__pseudo3_N2E3:AO353_03025 Length = 406 Score = 256 bits (655), Expect = 6e-73 Identities = 143/381 (37%), Positives = 216/381 (56%), Gaps = 9/381 (2%) Query: 9 DKYSSKNYSPLKLALAKGRGAKVWDIEDNCYIDCISGFSVVNQGHCHPKIIKALQEQSQR 68 D+ NY+P +G G++VWD ID G +V GH HP ++ AL EQ+ + Sbjct: 14 DQVMVPNYAPAAFIPVRGAGSRVWDQSGRELIDFAGGIAVNVLGHAHPALVGALTEQANK 73 Query: 69 ITMVSRALYSDNLGKWEEKICKLANKENVLPMNTGTEAVETAIKMARKWGADIKNIDESS 128 + VS ++ + K+ + V N+G EA E A K+AR+ D Sbjct: 74 LWHVSNVFTNEPALRLAHKLIDATFADRVFFCNSGAEANEAAFKLARRVAHD--RFGSEK 131 Query: 129 SEIIAMNGNFHGRTLGSLSLSSQDSYKKGFGPLLNNIHYADFGDIEQLKKLINNQTTAII 188 EIIA +FHGRTL ++++ Q Y GFGP + I + F D++ LK I+++T A++ Sbjct: 132 YEIIAALNSFHGRTLFTVNVGGQSKYSDGFGPKITGITHVKFNDLDALKAAISDKTCAVV 191 Query: 189 LEPIQGEGGVNIPPTHFIQEVRQLCNEYNVLLIADEIQVGLGRTGKMFAMEWENTEPDIY 248 LEPIQGEGGV ++Q R+LC ++N LLI DE+Q G+GR+G++FA + PDI Sbjct: 192 LEPIQGEGGVLPADLAYLQGARELCTQHNALLIFDEVQTGMGRSGELFAYQHYGVTPDIL 251 Query: 249 LLGKSLGGGLYPISAVLANQDVMSVLTPGTHGSTFGGNPLACAVSMAALDVLNEEHLVQN 308 KSLGGG +PI+A+L +D+ L GTHG+T+GGNPLACAV+ A +DV+N ++ Sbjct: 252 TSAKSLGGG-FPIAAMLTTEDLAKHLVVGTHGTTYGGNPLACAVAEAVIDVVNTPEVLNG 310 Query: 309 ALDLGDRLLKHLQQIESE--LIVEVRGRGLFIGIELNVA----AQDYCEQMINKGVLCKE 362 D L+QI ++ L +VRG GL +G L+ A A+D +G++ + Sbjct: 311 VKAKHDLFKTRLEQIGAKYGLFTQVRGLGLLLGCVLSEAWKGKAKDVFNAAEREGLMILQ 370 Query: 363 TQGNIIRIAPPLVIDKDEIDE 383 ++IR AP LV++ +I+E Sbjct: 371 AGPDVIRFAPSLVVEDADIEE 391 Lambda K H 0.317 0.136 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 353 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 394 Length of database: 406 Length adjustment: 31 Effective length of query: 363 Effective length of database: 375 Effective search space: 136125 Effective search space used: 136125 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory