GapMind for catabolism of small carbon sources

 

Alignments for a candidate for deoD in Pseudomonas fluorescens FW300-N2E3

Align Pyrimidine/purine nucleoside phosphorylase; Adenosine phosphorylase; Cytidine phosphorylase; Guanosine phosphorylase; Inosine phosphorylase; Thymidine phosphorylase; Uridine phosphorylase; Xanthosine phosphorylase; EC 2.4.2.1; EC 2.4.2.2; EC 2.4.2.15; EC 2.4.2.4; EC 2.4.2.3 (characterized)
to candidate AO353_19295 AO353_19295 hypothetical protein

Query= SwissProt::P0C037
         (94 letters)



>FitnessBrowser__pseudo3_N2E3:AO353_19295
          Length = 94

 Score =  105 bits (263), Expect = 9e-29
 Identities = 51/93 (54%), Positives = 67/93 (72%), Gaps = 1/93 (1%)

Query: 1  MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEMTVISGALNVLLPDAT 60
          M + NEYF G VKSI F ++  G A++GVM  GEY F T++ E M V+SGAL V LPD++
Sbjct: 1  MFKVNEYFDGTVKSIAFGTAE-GPATIGVMAPGEYEFGTSQREIMHVVSGALTVKLPDSS 59

Query: 61 DWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRY 93
          DW+ + AGS FNVP +S+F L+VA  T+YLC Y
Sbjct: 60 DWETFAAGSQFNVPANSKFQLKVAVDTAYLCEY 92


Lambda     K      H
   0.314    0.129    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 45
Number of extensions: 3
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 94
Length of database: 94
Length adjustment: 10
Effective length of query: 84
Effective length of database: 84
Effective search space:     7056
Effective search space used:     7056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (20.6 bits)
S2: 39 (19.6 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory