Align aquaglyceroporin (characterized)
to candidate AO353_04175 AO353_04175 glycerol uptake facilitator GlpF
Query= CharProtDB::CH_024677 (281 letters) >FitnessBrowser__pseudo3_N2E3:AO353_04175 Length = 283 Score = 401 bits (1031), Expect = e-117 Identities = 195/279 (69%), Positives = 232/279 (83%) Query: 2 SQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTAG 61 SQ +L QC+AEFLGT LLIFFG GCVAALKVAGASFG WEIS+IWG+GV+MAIYLTAG Sbjct: 5 SQQPSLSSQCMAEFLGTALLIFFGTGCVAALKVAGASFGLWEISIIWGIGVSMAIYLTAG 64 Query: 62 VSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHHI 121 VSGAHLNPAV+IAL +FA F+KRK+ +I SQVAGAFCAA LVY LY NLFFDFEQTH + Sbjct: 65 VSGAHLNPAVSIALCIFADFEKRKLPLYIFSQVAGAFCAALLVYTLYSNLFFDFEQTHQM 124 Query: 122 VRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAPL 181 VRG+ S++LA FST+PNP ++ QAF VE++ITAILMG+I++LTDD NG+P+GPLAPL Sbjct: 125 VRGTQASLELASVFSTFPNPALSTAQAFLVEVIITAILMGVIMSLTDDNNGLPKGPLAPL 184 Query: 182 LIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGPI 241 LIGLLIAVIG+SMGPLTGFAMNPARDFGPK+ + AGWG ++FTGGRDIPYFL+P+F PI Sbjct: 185 LIGLLIAVIGSSMGPLTGFAMNPARDFGPKLMTFFAGWGEISFTGGRDIPYFLIPIFAPI 244 Query: 242 VGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKAS 280 +GA +GA AYR LI RHLP I ++ E + + S Sbjct: 245 LGACLGAAAYRGLIARHLPIAIPATKDAEPAIDGKARIS 283 Lambda K H 0.327 0.143 0.451 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 338 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 283 Length adjustment: 26 Effective length of query: 255 Effective length of database: 257 Effective search space: 65535 Effective search space used: 65535 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory