Align Probable ATP-binding component of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate AO353_28150 AO353_28150 arginine aminotransferase
Query= TCDB::Q9HU32 (257 letters) >FitnessBrowser__pseudo3_N2E3:AO353_28150 Length = 667 Score = 340 bits (873), Expect = 3e-98 Identities = 165/254 (64%), Positives = 214/254 (84%) Query: 4 ATPALEIRNLHKRYGDLEVLKGISLTARDGDVISILGSSGSGKSTFLRCINLLENPHQGQ 63 A +E+ LHKR+G++EVLKG+SLTAR+GDVIS++G+SGSGKST LRCIN+LE P QG+ Sbjct: 412 AKTMIEVDGLHKRFGNIEVLKGVSLTAREGDVISLIGASGSGKSTLLRCINMLEVPDQGR 471 Query: 64 ILVSGEELRLKKSKNGDLVAADSQQINRLRSELGFVFQNFNLWPHMSILDNVIEAPRRVL 123 ILV GE ++L + G + +D++Q+ R+RS LG VFQNFNLWPH ++L+N+IEAP +VL Sbjct: 472 ILVDGESIQLNFDRPGAPLVSDAKQLVRIRSSLGMVFQNFNLWPHRTVLENLIEAPTQVL 531 Query: 124 GKSKAEAIEIAEGLLAKVGIADKRHSYPAQLSGGQQQRAAIARTLAMQPKVILFDEPTSA 183 +S+AEA E AE LL +VG+A KR+ YPA LSGGQQQR AIAR LAM+PKV+LFDEPTSA Sbjct: 532 RESRAEATERAEALLERVGLAAKRNEYPAFLSGGQQQRVAIARALAMRPKVMLFDEPTSA 591 Query: 184 LDPEMVQEVLNVIRALAEEGRTMLLVTHEMSFARQVSSEVVFLHQGLVEEQGTPQQVFEN 243 LDPE+V EVL VIR+LAEEGRTM+LVTHEM+FAR VSS+V +LHQGL+EE G+P +VF + Sbjct: 592 LDPELVGEVLRVIRSLAEEGRTMILVTHEMAFARDVSSKVAYLHQGLIEEAGSPDEVFVH 651 Query: 244 PQSARCKQFMSSHR 257 P+S RC+QF+++H+ Sbjct: 652 PRSERCRQFVNAHQ 665 Lambda K H 0.317 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 667 Length adjustment: 31 Effective length of query: 226 Effective length of database: 636 Effective search space: 143736 Effective search space used: 143736 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory