Align glucose transporter, ATPase component (characterized)
to candidate AO353_17105 AO353_17105 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >FitnessBrowser__pseudo3_N2E3:AO353_17105 Length = 233 Score = 117 bits (294), Expect = 2e-31 Identities = 63/218 (28%), Positives = 124/218 (56%), Gaps = 6/218 (2%) Query: 15 LVEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEIRV 74 +++ +++S +G I+A+ V+V++ GE+V L+G NGAGKSTL+ L G+ Q +G IR Sbjct: 1 MLQFENVSTFYGKIQALHGVNVEVRQGEIVTLIGANGAGKSTLLMTLCGSPQAHSGSIRY 60 Query: 75 NGDKVEITNPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTPFGLVDDSAMEAECR 134 G+++ + +I + + + L NL +G + + + Sbjct: 61 MGEELVGQDSARIMRKSIAVVPEGRRVFARLTVEENLAMGGFFT------EKGDYQEQMD 114 Query: 135 KIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAALGPHETQMVAE 194 K++ ++F++ +SGG++Q +AI RA+ K+L++DEP+ L P Q + + Sbjct: 115 KVLGLFPRLKERFNQRGGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFD 174 Query: 195 LIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLV 232 +I+QL+ G+ +FL++ + N +++ DRA V++NG++V Sbjct: 175 IIEQLRKDGVTVFLVEQNANQALKVADRAYVLENGRVV 212 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 130 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 233 Length adjustment: 24 Effective length of query: 236 Effective length of database: 209 Effective search space: 49324 Effective search space used: 49324 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory