Align D-lactate oxidase and glycolate oxidase, FAD binding subunit (EC 1.1.3.15) (characterized)
to candidate AO353_21305 AO353_21305 glycolate oxidase
Query= reanno::psRCH2:GFF3771 (353 letters) >FitnessBrowser__pseudo3_N2E3:AO353_21305 Length = 352 Score = 514 bits (1325), Expect = e-150 Identities = 251/346 (72%), Positives = 286/346 (82%), Gaps = 2/346 (0%) Query: 7 DASAQLLDQVNQALAANTPLRIQGSGSKSFLGLQADGVLLDTREHRGIVSYDPTELVVTV 66 DASA+LL+Q+NQA TPLRIQG+ SK+FLG + G +LDTR HRGIVSYDPTELV+T Sbjct: 8 DASAELLEQINQARENATPLRIQGASSKAFLGREVAGEVLDTRVHRGIVSYDPTELVITA 67 Query: 67 RAGTPLTELETALDEAGQMLPCEPPHFGEGATVGGMIAAGLSGPRRPWSGSVRDFVLGSR 126 R GTPL EL ALD AGQMLPCEPP FGE ATVGGMIAAGLSGPRRPW+GS RDFVLG+R Sbjct: 68 RCGTPLRELLAALDAAGQMLPCEPPSFGEDATVGGMIAAGLSGPRRPWAGSARDFVLGTR 127 Query: 127 VITGQGKHLRFGGEVMKNVAGYDLSRLMAGSFGCLGVLTEVSLKVLPKPRLCTSLRLEID 186 +ITG GK LRFGGEVMKNVAGYDLSRL+ GSFGCLGV+TEVSLKVLPKPR C S+ LE+D Sbjct: 128 LITGNGKQLRFGGEVMKNVAGYDLSRLLTGSFGCLGVITEVSLKVLPKPRQCLSISLELD 187 Query: 187 LERALLKLAEWGQQPIPISAASHDGQALHLRLEGGEGSVGAARERIGGEDLDPGYWNDLR 246 AL KLAEWGQQP+PISAA HDG+ LHLRLEGGEGSV AA +R+GGE LD +W L Sbjct: 188 SAHALSKLAEWGQQPLPISAACHDGRQLHLRLEGGEGSVSAAHQRLGGEVLDAQFWEALN 247 Query: 247 EQRLAFFADPRPLWRLSLPNNTPALGLPGDQLVDWAGAQRWLKSDADAVTIRGIAIEVGG 306 EQ+L FF + PLWRLSLPNN L LPG+QL+DWAGAQRWLKS+A I+ +A ++GG Sbjct: 248 EQQLTFFDEGLPLWRLSLPNNIGPLTLPGEQLIDWAGAQRWLKSEAP--NIQSLAADLGG 305 Query: 307 HATCFTAGATTNPFQPLAAPLLRYHRQLKAALDPQGIFNPGRMYSE 352 HATC++ G + PFQPLA LLRYH+QLKA LDPQG+FNPGRMY+E Sbjct: 306 HATCYSHGVSDTPFQPLAPALLRYHQQLKAQLDPQGLFNPGRMYAE 351 Lambda K H 0.319 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 483 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 352 Length adjustment: 29 Effective length of query: 324 Effective length of database: 323 Effective search space: 104652 Effective search space used: 104652 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory