Align 3-oxoadipate enol-lactonase (EC 3.1.1.24) (characterized)
to candidate AO353_19350 AO353_19350 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase
Query= BRENDA::Q13KT2 (263 letters) >FitnessBrowser__pseudo3_N2E3:AO353_19350 Length = 270 Score = 107 bits (268), Expect = 2e-28 Identities = 85/280 (30%), Positives = 136/280 (48%), Gaps = 29/280 (10%) Query: 1 MPYAAVNGTELHYRIDGERHGNAPWIVLSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGH 60 MP+A ++G LHY +D G P ++L+ S D +MWAPQ+ ALS+H RV+ D GH Sbjct: 1 MPFATIDGQLLHY-VD---QGTGPVVLLAGSYLWDQAMWAPQIVALSQHHRVIAVDLWGH 56 Query: 61 GHS-EAPKGPYTIEQLTGDVLGLMDTLKIARANFCGLSMGGLTGVALAARHADRIERVAL 119 G S P+G +++ VL L+D L I R GLS+GG+ GV LA R+ + L Sbjct: 57 GESGPLPEGMTSLDDQARQVLALLDHLDIDRVTLVGLSVGGMWGVRLALSAPQRLNGLVL 116 Query: 120 CNTAARIGSPEV----WVPRAVKARTEGMHA--LADAVLPRWF-------TADYMEREPV 166 +T + PE+ + + G+ + L D V+P +F +A Y + Sbjct: 117 MDTYVGV-EPELTRQYYFSLFKQIEDSGVISPQLLDIVVPIFFRPGIDPQSALYQDFRAR 175 Query: 167 VLAM----IRDVFVHTDKEGYASNCEAIDAADLRPEAPGIKVPALVISGTHDLAATPAQG 222 + A+ +R+ V + + + +L PE L++ G D P + Sbjct: 176 LAALPPERLRESIVPMGRITFGRDDLLPRLGELNPET------TLLMCGDQDKPRPPLET 229 Query: 223 RELAQAIAGARYVELDASHISNIERADAFTKTVVDFLTEQ 262 RE+A+ I + +A HISN+E + TK ++ FL E+ Sbjct: 230 REMAELIGCPYLLVPEAGHISNLENPEFVTKALLKFLAER 269 Lambda K H 0.320 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 169 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 270 Length adjustment: 25 Effective length of query: 238 Effective length of database: 245 Effective search space: 58310 Effective search space used: 58310 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory