Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate AO353_26540 AO353_26540 enoyl-CoA hydratase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__pseudo3_N2E3:AO353_26540 Length = 270 Score = 145 bits (365), Expect = 1e-39 Identities = 85/266 (31%), Positives = 136/266 (51%), Gaps = 11/266 (4%) Query: 2 EFETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAF 61 E++ + N+ + +NRP+K+NA+NA E+ + E+R ++I+G GK F Sbjct: 3 EYQAFRVELSDNIAHVQINRPEKINAMNAVFWTEIIEIFQWIDDTDEVRAVVISGAGKHF 62 Query: 62 CAGADITQFNQLTPAEAWKFSKKGREIMDKIEALS----------KPTIAMINGYALGGG 111 +G D+ + + R + KI AL KP +A I GY LGG Sbjct: 63 SSGIDLMMLASVANEMGKDAGRNARLLRRKILALQASFNAVDNCRKPVLAAIQGYCLGGA 122 Query: 112 LELALACDIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKD 171 ++L ACD+R AAE+AQ + EI++G+ G QRL R+IG G E+ TG ++ Sbjct: 123 IDLISACDMRYAAEDAQFSIKEIDMGMAADVGTLQRLPRIIGDGMLRELAYTGRTFGAEE 182 Query: 172 AEKYGLVNRVVP-LANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESV 230 A GLVNRV P +L +A +IA KSPI++A KE+++ D + GL + Sbjct: 183 ARSIGLVNRVYPDTTSLLDGVMGIAREIAAKSPIAIAGTKEMISYMRDHSINDGLEYIAT 242 Query: 231 GWGVVFSTEDKKEGVSAFLEKREPTF 256 + + D + ++A + K++P F Sbjct: 243 WNAAMLQSTDLRVAMAASMSKQKPEF 268 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 137 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 270 Length adjustment: 25 Effective length of query: 234 Effective length of database: 245 Effective search space: 57330 Effective search space used: 57330 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory