GapMind for catabolism of small carbon sources

 

Protein AO356_23210 in Pseudomonas fluorescens FW300-N2C3

Annotation: FitnessBrowser__pseudo5_N2C3_1:AO356_23210

Length: 340 amino acids

Source: pseudo5_N2C3_1 in FitnessBrowser

Candidate for 28 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
myo-inositol catabolism PS417_11895 hi m-Inositol ABC transporter, permease component (iatP) (characterized) 98% 100% 634 Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR 41% 226.5
xylitol catabolism PS417_12060 med ABC transporter permease; SubName: Full=Monosaccharide ABC transporter membrane protein, CUT2 family; SubName: Full=Sugar ABC transporter permease (characterized, see rationale) 45% 100% 273.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-cellobiose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 226.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-glucose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 226.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
lactose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 226.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-maltose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 226.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
sucrose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 226.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
trehalose catabolism mglC med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 226.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-xylose catabolism xylH med Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 41% 97% 226.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-fructose catabolism frcC med Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 43% 91% 219.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
sucrose catabolism frcC med Ribose ABC transport system, permease protein RbsC (characterized, see rationale) 43% 91% 219.5 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-ribose catabolism rbsC med Ribose import permease protein RbsC (characterized) 40% 95% 216.1 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-mannose catabolism HSERO_RS03645 med ABC-type sugar transport system, permease component protein (characterized, see rationale) 41% 88% 215.3 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
myo-inositol catabolism iatP med Inositol ABC transport system, permease protein IatP, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized) 41% 91% 214.9 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-galactose catabolism mglC lo MglC aka B2148, component of Galactose/glucose (methyl galactoside) porter (characterized) 36% 94% 205.7 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-xylose catabolism xylF_Tm lo ABC-type transporter, integral membrane subunit, component of Xylose porter (Nanavati et al. 2006). Regulated by xylose-responsive regulator XylR (characterized) 38% 99% 201.4 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
L-fucose catabolism HSERO_RS05255 lo ABC-type sugar transport system, permease component protein (characterized, see rationale) 34% 97% 195.3 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
L-arabinose catabolism araH lo L-arabinose ABC transporter, permease protein AraH (characterized) 36% 82% 182.2 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-galactose catabolism BPHYT_RS16925 lo Arabinose ABC transporter permease (characterized, see rationale) 34% 98% 180.3 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-mannose catabolism frcC lo Fructose import permease protein FrcC (characterized) 33% 89% 175.6 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-ribose catabolism frcC lo Fructose import permease protein FrcC (characterized) 33% 89% 175.6 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-galactose catabolism ytfT lo Galactofuranose transporter permease protein YtfT (characterized) 33% 95% 172.6 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
L-arabinose catabolism araWsh lo Inner-membrane translocator (characterized, see rationale) 34% 80% 167.2 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
L-rhamnose catabolism rhaP lo RhaP, component of Rhamnose porter (Richardson et al., 2004) (Transport activity is dependent on rhamnokinase (RhaK; AAQ92412) activity (Richardson and Oresnik, 2007) This could be an example of group translocation!) (characterized) 31% 93% 162.2 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-fructose catabolism fruG lo Fructose import permease protein FruG (characterized) 31% 97% 154.8 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
sucrose catabolism fruG lo Fructose import permease protein FruG (characterized) 31% 97% 154.8 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
D-fructose catabolism fruF lo Fructose import permease protein FruF (characterized) 32% 82% 148.3 m-Inositol ABC transporter, permease component (iatP) 98% 634.0
sucrose catabolism fruF lo Fructose import permease protein FruF (characterized) 32% 82% 148.3 m-Inositol ABC transporter, permease component (iatP) 98% 634.0

Sequence Analysis Tools

View AO356_23210 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MNAILENKPAAAPTRSRRRLPTELSIFLVLIGIGLVFEMFGWIMRDQSFLMNSQRLVLMI
LQVSIIGLLAIGVTQVIITTGIDLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVW
IPVVAGLGVGLLAGAINGSIIAITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYT
AIGHGAMPVIIFLVVAVIFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIA
GLLAGLAGVVASARAATGQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGV
MASGFTFVGVDAYIQDIIKGLIIVVAVVIDQYRNKRKLKR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory