Align 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) (characterized)
to candidate AO356_07160 AO356_07160 4-carboxymuconolactone decarboxylase
Query= BRENDA::Q6SJC5 (136 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_07160 Length = 126 Score = 98.6 bits (244), Expect = 3e-26 Identities = 49/116 (42%), Positives = 69/116 (59%) Query: 12 TDRYTTGMDTRRRVLGDAHVDRAEACKSDFDAPFQTLITEGAWGTVWASDAISPRERSML 71 TD TG+D RR+V+GDA VDRA ++F P Q + E AWG+VW + + + RS++ Sbjct: 2 TDTPKTGLDMRRQVMGDAFVDRALGNATEFTQPLQDFVNEHAWGSVWQREGLPLKTRSLI 61 Query: 72 TLALLAATGNFEEIPMHIRATARTGASQSDVIEAFQHVAIYAGVPRANHAIRLAKE 127 TLA L A +E+ H+R G + ++ EA H A+YAGVP A A R A+E Sbjct: 62 TLAALTALKCPQELKGHVRGALNNGCTVEEIREALLHCAVYAGVPAAIDAFRAAQE 117 Lambda K H 0.317 0.128 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 54 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 136 Length of database: 126 Length adjustment: 14 Effective length of query: 122 Effective length of database: 112 Effective search space: 13664 Effective search space used: 13664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 41 (20.4 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory