Align ABC transporter for D-Alanine, permease component 1 (characterized)
to candidate AO356_18220 AO356_18220 amino acid ABC transporter permease
Query= reanno::pseudo6_N2E2:Pf6N2E2_5404 (365 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_18220 Length = 223 Score = 129 bits (324), Expect = 7e-35 Identities = 71/208 (34%), Positives = 122/208 (58%), Gaps = 7/208 (3%) Query: 155 WGGLMLTLVIATVGIVGALPLGIVLALGRRSNMPAIRVVCVTFIEFWRGVPLITVLFMSS 214 W G+++TL + +G+VG + LG +LAL R S+ I + ++ ++R +PL+ V+ Sbjct: 16 WNGMVMTLKLMAMGVVGGIILGTILALMRLSHNKLISNIAGAYVNYFRSIPLLLVITWFY 75 Query: 215 VMLPLFLPEGMNFDKLLRA----LIGVILFQSAYIAEVVRGGLQAIPKGQYEAAAAMGLG 270 + +P L D + A ++ ++F++AY E+VR G+Q+IPKGQ AA A+G+ Sbjct: 76 LAVPFVLRWITGEDTPIGAFGSCVVAFMMFEAAYFCEIVRAGVQSIPKGQMGAAQALGMN 135 Query: 271 YWRSMGLVILPQALKLVIPGIVNTFIALFKDTSLVIIIGLFDLLNSVKQAAADPKWLGMA 330 Y ++M L+ILPQA + + P ++ I LF+DTSLV +GL D LN+ + A+ +G + Sbjct: 136 YGQTMRLIILPQAFRKMTPLLLQQSIILFQDTSLVYTVGLVDFLNA---SRANGDIIGRS 192 Query: 331 TEGYVFAALVFWIFCFGMSRYSMHLERK 358 E + A LV++ F S L+++ Sbjct: 193 NEFLIVAGLVYFTISFAASLLVKRLQKR 220 Lambda K H 0.330 0.144 0.469 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 281 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 365 Length of database: 223 Length adjustment: 26 Effective length of query: 339 Effective length of database: 197 Effective search space: 66783 Effective search space used: 66783 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory