Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate AO356_29020 AO356_29020 ABC transporter ATP-binding protein
Query= TCDB::P21629 (255 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_29020 Length = 256 Score = 196 bits (498), Expect = 4e-55 Identities = 100/249 (40%), Positives = 155/249 (62%) Query: 5 ILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIRL 64 +LEV +++ F G+ A++ ++ V+ ++ ++IGPNGAGK+++ N L G Y+ G + Sbjct: 4 LLEVRNVSLSFQGVKAISDLSFSVKLGEICALIGPNGAGKSSLLNILNGVYRADAGQLFF 63 Query: 65 DGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFR 124 E ++ K AR G+ RTFQN LFK+M+ V+NLL R T FL P R Sbjct: 64 AAEPLRRPHPLKAARLGIGRTFQNNALFKKMSVVDNLLTGLSRFQRTFFLEQALGLPRAR 123 Query: 125 RSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAAGL 184 R R E A LE + L + + + G+LAYG Q+R+E+ R ++ +P +L+LDEP AG+ Sbjct: 124 REARAFAERAERVLEFLELQAWRDVAVGSLAYGLQKRVELGRALIAQPTLLLLDEPMAGM 183 Query: 185 NPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIRDN 244 N +E D+ IA + + TV+LIEHD+++VM +S H+VV++ G + DGTP +++ N Sbjct: 184 NAEEKQDMSRFIADINRDLGTTVILIEHDIQVVMGLSSHVVVLDYGRKVGDGTPAEVQAN 243 Query: 245 PDVIKAYLG 253 PDVI AYLG Sbjct: 244 PDVIAAYLG 252 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 171 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 256 Length adjustment: 24 Effective length of query: 231 Effective length of database: 232 Effective search space: 53592 Effective search space used: 53592 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory