Align general amino acid permease AGP1 (characterized)
to candidate AO356_18530 AO356_18530 aromatic amino acid transporter
Query= CharProtDB::CH_091105 (633 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_18530 Length = 471 Score = 202 bits (514), Expect = 3e-56 Identities = 131/432 (30%), Positives = 214/432 (49%), Gaps = 16/432 (3%) Query: 113 SDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQAC 172 S LK+ ++ RH+ +IALG IGTGL +G+ L AGP+ +++GYAI G I + I++ Sbjct: 8 SGELKRGLKNRHIQLIALGGAIGTGLFLGSAGVLKSAGPS-MILGYAICGFIAFMIMRQL 66 Query: 173 GEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSV 232 GEM +V + G ++ + GF W + ++ V EL I YW + Sbjct: 67 GEM-IVEEPVAGSFSHFAHKYWGGFAGFLSGWNCWILYILVGMSELTAVGKYIHYWAPDI 125 Query: 233 NPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFI 292 V F++L+ IN+ + + EAEF+F K++ + G LG + V G G Sbjct: 126 PTWVSAAAFFILINAINLANVKVFGEAEFWFAIIKVVAIVGMIALGSYLLVSGHGGPQAS 185 Query: 293 GGKYWHDPGAF-NGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAK 351 W G F NG G+ + F+FGG E + T AE P+ IP A Sbjct: 186 VTNLWSHGGFFPNG------VSGLVMAMAIIMFSFGGLEMLGFTAAEADKPKTVIPKAIN 239 Query: 352 QMIYRILFLFLATIILLGFLVPYNSD-QLLGSTGGGTKASPYVIAVASHGVRVVPHFINA 410 Q+IYRIL ++ +++L L P++S L ++G SP+V + G H +N Sbjct: 240 QVIYRILIFYIGALVVLLSLTPWDSLLATLNASGDAYSGSPFVQVFSMLGSNTAAHILNF 299 Query: 411 VILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCA 470 V+L + LS+ NS Y ++R+ L ++EQG APK S ID+ G P+ ++ SA ++A Sbjct: 300 VVLTAALSVYNSGTYCNSRMLLGMAEQGDAPKALSRIDKRGVPVRSILASAAVTLVAVLL 359 Query: 471 ASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAM-KVQGRSLGELGFKSQTGVWGS 529 + L+++ + + W I SH +FR+ M + Q L FK+ +G+ Sbjct: 360 NYLVPQHALELLMSLVVATLVINWAMISYSHFKFRQHMNQTQQTPL----FKALWYPYGN 415 Query: 530 AYACIMMILILI 541 Y C+ ++ ++ Sbjct: 416 -YICLAFVVFIL 426 Lambda K H 0.324 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 699 Number of extensions: 37 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 633 Length of database: 471 Length adjustment: 35 Effective length of query: 598 Effective length of database: 436 Effective search space: 260728 Effective search space used: 260728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory