Align ABC transporter for L-Asparagine and possibly other L-amino acids, periplasmic substrate-binding component (characterized)
to candidate AO356_18230 AO356_18230 ABC transporter
Query= reanno::pseudo13_GW456_L13:PfGW456L13_4770 (304 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_18230 Length = 304 Score = 579 bits (1493), Expect = e-170 Identities = 291/304 (95%), Positives = 298/304 (98%) Query: 1 MRIVPHILGAAIAAALISTPVFAAELTGTLKKIKESGTITLGHRDASIPFSYIADASGKP 60 MRIVPH+LGAAIAAALISTPVFAAELTGTLKKIKESG ITLGHRDASIPFSYIADASGKP Sbjct: 1 MRIVPHLLGAAIAAALISTPVFAAELTGTLKKIKESGVITLGHRDASIPFSYIADASGKP 60 Query: 61 VGYSHDIQLKVVEALKKDLDMPNLQVKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQ 120 VGYSHDIQLKVVEA+KKDLD+PNLQVKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQ Sbjct: 61 VGYSHDIQLKVVEAIKKDLDLPNLQVKYNLVTSQTRIPLVQNGTVDLECGSTTNNVERQQ 120 Query: 121 QVDFSVGIFEIGTRLLSKADSKYKDFPDLAGKNVVTTAGTTSERILKAMNADKQMGMNVI 180 QVDFSVGIFEIGTRLL+K DSKYKDF DL GKNVVTTAGTTSER+LK+MNADKQMGMNVI Sbjct: 121 QVDFSVGIFEIGTRLLTKKDSKYKDFDDLKGKNVVTTAGTTSERLLKSMNADKQMGMNVI 180 Query: 181 SAKDHGESFQMLETGRAVAFMMDDALLAGEAAKAKKASDWAVTGTPQSYEIYGCMVRKGD 240 SAKDHGESFQMLE GRAVAFMMDDALLAGEAAKAKKA DWAVTGTPQSYEIYGCM+RKGD Sbjct: 181 SAKDHGESFQMLEGGRAVAFMMDDALLAGEAAKAKKADDWAVTGTPQSYEIYGCMMRKGD 240 Query: 241 EPFKKAVDDAIKATYASGEINKIYEKWFMQPIPPKGLNLNFPMSDELKALIAKPTDKAAD 300 EPFKKAVDDAIKATYASGEINKIYEKWFMQPIPPKGLNLNFPMSDELKALIAKPTDKAAD Sbjct: 241 EPFKKAVDDAIKATYASGEINKIYEKWFMQPIPPKGLNLNFPMSDELKALIAKPTDKAAD 300 Query: 301 DKKS 304 DKKS Sbjct: 301 DKKS 304 Lambda K H 0.315 0.131 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 400 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 304 Length adjustment: 27 Effective length of query: 277 Effective length of database: 277 Effective search space: 76729 Effective search space used: 76729 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.5 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory