Align BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate AO356_10240 AO356_10240 amino acid ABC transporter permease
Query= TCDB::Q52665 (434 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_10240 Length = 221 Score = 89.4 bits (220), Expect = 1e-22 Identities = 71/231 (30%), Positives = 116/231 (50%), Gaps = 18/231 (7%) Query: 204 IEAALQSALPLALPEVDSDQF--GGFLLALVIGVTAIVVSLPLGILLALGRQSDMLIVKS 261 +EAALQ AL DS F G +++ + + L LG LAL R S +V Sbjct: 1 MEAALQLAL-------DSAPFLLKGAYYTVILSLGGMFFGLLLGFGLALMRLSRFKLVSW 53 Query: 262 LSVGIIEFVRGVPLITLLFTASLLLQYFLPP-GTNFDLILRVVILVTLFAAAYIAEVIRG 320 ++ + F RG PL+ LF ++ Y LP G D + +I +L AAY E++R Sbjct: 54 IARIYVSFFRGTPLLVQLF----VIYYGLPQLGIELDPLPAALIGFSLNMAAYACEILRA 109 Query: 321 GLAALPRGQYEAADALGLDYWQAQRLIIMPQALKISIPGIVSSFIGLFKDTTLVAFVGLF 380 ++++ RGQ+EAA ++G+ Q R I+PQA + ++P + +SFI L KDT L A + + Sbjct: 110 AISSIERGQWEAAASIGMTRAQTLRRAILPQAARTALPPLGNSFISLVKDTALAATIQVP 169 Query: 381 DPLKGISNVVRSDMAWKGTYWEPYIFVALIFFLFNFSMSRYSMYLERKLKR 431 + + + A + Y+ ALI+++ +S LE ++ R Sbjct: 170 ELFRQAQLIT----ARTFEIFTMYLAAALIYWVLATVLSHLQNVLEARVNR 216 Lambda K H 0.329 0.143 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 221 Length adjustment: 27 Effective length of query: 407 Effective length of database: 194 Effective search space: 78958 Effective search space used: 78958 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory