Align MsiK protein, component of The cellobiose/cellotriose (and possibly higher cellooligosaccharides), CebEFGMsiK [MsiK functions to energize several ABC transporters including those for maltose/maltotriose and trehalose] (characterized)
to candidate AO356_00010 AO356_00010 ABC transporter ATP-binding protein
Query= TCDB::P96483 (377 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_00010 Length = 365 Score = 299 bits (766), Expect = 7e-86 Identities = 163/353 (46%), Positives = 224/353 (63%), Gaps = 33/353 (9%) Query: 1 MATVTFDKATRIYPGSDKPAVDQLDIAIEDGEFLVLVGPSGCGKSTSLRMLAGLEDVNGG 60 MAT+ + + + G + +D+ ++D EF+V VGPSGCGKST LR++AGLEDV G Sbjct: 1 MATLKIENLKKGFEGLS--IIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSG 58 Query: 61 AIRIGDRDVTHLPPKDRDIAMVFQNYALYPHMTVADNMGFALKIAGVPKAEIRQKVEEAA 120 I + RD+T + P RD+AMVFQ YALYPHMTV N+ FAL +AG K ++ +KV EAA Sbjct: 59 TIELDGRDITEVTPAKRDLAMVFQTYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAA 118 Query: 121 KILDLTQYLDRKPKALSGGQRQRVAMGRAIVREPQVFLMDEPLSNLDAKLRVSTRTQIAS 180 +IL+L LDRKPK LSGGQRQRVA+GRAIVR P++FL DEPLSNLDA LRV TR +++ Sbjct: 119 RILELGSLLDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSR 178 Query: 181 LQRRLGITTVYVTHDQVEAMTMGDRVAVLKDGLLQQVDSPRNMYDKPANLFVAGFIGSPA 240 L + L T +YVTHDQVEAMT+ +V VL G ++Q+ SP +Y PANLFVAGF+G+P Sbjct: 179 LHKELQATMIYVTHDQVEAMTLATKVVVLNAGRIEQIGSPLELYHHPANLFVAGFLGTPK 238 Query: 241 MNLVEVPI-----TDGGVKFGNS---VVPVNREALSAADKGDRTVTVGVRPEHFDVVELG 292 M ++ + + V+F + ++P + ALS ++VT+G+RPEH Sbjct: 239 MGFLQATVHAVHASGVEVRFASGTTLLIPRDSSALSVG----QSVTIGIRPEHL------ 288 Query: 293 GAVAASLSKDSADAPAGLAVSVNVVEELGADGYVYGTAEVGGEVKDLVVRVNG 345 + A + V+ +V E LG+D + + + G + L VRV G Sbjct: 289 ----------TLGAEGQVLVTTDVTERLGSDTFCHVNVDSG---ESLTVRVQG 328 Lambda K H 0.317 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 371 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 365 Length adjustment: 30 Effective length of query: 347 Effective length of database: 335 Effective search space: 116245 Effective search space used: 116245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory