Align UDP-glucose 4-epimerase (EC 5.1.3.2) (characterized)
to candidate AO356_14875 AO356_14875 NAD-dependent dehydratase
Query= BRENDA::F2NQX6 (314 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_14875 Length = 309 Score = 207 bits (527), Expect = 3e-58 Identities = 125/308 (40%), Positives = 175/308 (56%), Gaps = 15/308 (4%) Query: 3 VLVTGGAGFIGSHLVHALHQKGIPVAVLDDLSTGKRAHIP---PDVPLYQTDIRDLNAVL 59 VL+TGGAGFIGSHL AL KG V +LDDLSTGKR+++P P V L + D+ D V Sbjct: 6 VLITGGAGFIGSHLTDALLAKGHAVRILDDLSTGKRSNLPLDNPAVELIEGDVADAALVA 65 Query: 60 HAFQDFQPTHVAHQAAQASVKHSVQNPCKDAEINLLGGLNILEAMRATGTQKIVFASTGG 119 A VAH AA ASV+ SV +P + + N +G LN+ EAMR G ++++FAS+ Sbjct: 66 RAMAGCSA--VAHLAAVASVQASVDDPVRTHQSNFIGTLNVCEAMRQAGVKRVLFASSA- 122 Query: 120 AIYGEVPEGRRAPETWPPKPKSPYAASKAAFEHYLEVYRQTHGLTYTTLRYANVYGPRQD 179 A+YG EG E P P +PYA+ K A E Y + YR+ H L R+ N+YGPRQD Sbjct: 123 AVYGNNGEGESIDEETPKAPLTPYASDKLASEFYFDFYRRQHALEPVVFRFFNIYGPRQD 182 Query: 180 PHGE-AGVVAIFTNRLLHAQPVTLYARKEPGDPGCIRDYIHVEDVTRANLLALE-TNLE- 236 P +GV++IF+ R P+T++ GD RD+++VED+ + A+E +E Sbjct: 183 PSSPYSGVISIFSERAQKGLPITVF-----GDGEQTRDFVYVEDLVDLLVQAIEKPEVEV 237 Query: 237 GTYNVSTGQGRTTEDVLYTIARALGTTPRVTYAPPRDGDLEVSVLDPTQ-LQAHGWRPQV 295 G NV Q T + +L +A +G P ++Y P R GD+ S D + L+ + PQ Sbjct: 238 GAVNVGWNQATTLKQMLQALAAVVGDLPPISYGPARSGDIRHSRADNHRLLERFSFPPQT 297 Query: 296 PFEEGIRR 303 P G+ R Sbjct: 298 PMSVGLAR 305 Lambda K H 0.318 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 252 Number of extensions: 14 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 314 Length of database: 309 Length adjustment: 27 Effective length of query: 287 Effective length of database: 282 Effective search space: 80934 Effective search space used: 80934 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory