Align Galactose 1-dehydrogenase; EC 1.1.1.48 (characterized)
to candidate AO356_28440 AO356_28440 galactose 1-dehydrogenase
Query= SwissProt::P11886 (304 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28440 Length = 308 Score = 515 bits (1327), Expect = e-151 Identities = 260/308 (84%), Positives = 276/308 (89%), Gaps = 4/308 (1%) Query: 1 MQPIRLGLVGYGKIAQDQHVPAINANPAFTLVSVATQGKPCPGVENFQSLGELLENGPPV 60 MQPIRLGLVGYGKIAQDQHVPAI ANPAF LV+VATQG+PC GVENF+SLGELLENGP V Sbjct: 1 MQPIRLGLVGYGKIAQDQHVPAILANPAFQLVAVATQGQPCAGVENFRSLGELLENGPHV 60 Query: 61 DAIAFCTPPQGRFALVQQALAAGKHVLVEKPPCATLGKAALWIK--REQA-SAPCSPCIA 117 DAIAFCTPPQGRFALVQQALAAGKHVLVEKPPCATLG+A ++ REQ S + Sbjct: 61 DAIAFCTPPQGRFALVQQALAAGKHVLVEKPPCATLGEAMALVEQVREQGVSGLFAWHSR 120 Query: 118 YAPAIAAARDWLATRTLQSVQIDWKEDVRKWHPGQAWIWQPG-LGVFDPGINALSIVTHL 176 YAP IAAARDWLA+RTL SVQIDWKEDVRKWHPGQAWIWQPG LGVFDPGINALSI THL Sbjct: 121 YAPGIAAARDWLASRTLHSVQIDWKEDVRKWHPGQAWIWQPGGLGVFDPGINALSIATHL 180 Query: 177 LPLPLFVESAELRVPSNCQSPIAASIKMSDPRLLDVRAEFDFDHGHDELWSIQIRCAEGT 236 L LPLFVE+AELRVP NCQSPIAASIKM+D R LD+RAEFDFDHGHDELWSI+IRCAEG Sbjct: 181 LALPLFVEAAELRVPDNCQSPIAASIKMADARHLDIRAEFDFDHGHDELWSIEIRCAEGV 240 Query: 237 LRLDNGGALLSIDGVRQTVAEEGEYAAVYRHFQQLIGDKTSDVDVQPLRLVADSFFVGSR 296 LRLDNGGALLSIDGVRQ V+EEGEYAAVYRHFQQLI DK SD+D+QPLRLVADSFFVGSR Sbjct: 241 LRLDNGGALLSIDGVRQAVSEEGEYAAVYRHFQQLINDKASDMDLQPLRLVADSFFVGSR 300 Query: 297 VSVEAFYD 304 +VE FYD Sbjct: 301 TAVEPFYD 308 Lambda K H 0.321 0.137 0.428 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 402 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 304 Length of database: 308 Length adjustment: 27 Effective length of query: 277 Effective length of database: 281 Effective search space: 77837 Effective search space used: 77837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory