Align Tagatose-6-phosphate kinase; EC 2.7.1.144; Phosphotagatokinase (uncharacterized)
to candidate AO356_07330 AO356_07330 1-phosphofructokinase
Query= curated2:Q5HM37 (310 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_07330 Length = 313 Score = 144 bits (363), Expect = 3e-39 Identities = 89/283 (31%), Positives = 150/283 (53%), Gaps = 4/283 (1%) Query: 2 ILTLTLNPSVDISYPLDQFNLDTVNRVSQTSKTAGGKGLNVTRVLSEFGEDVIASGFLGG 61 ILTLTLNP++D++ L + VNR A GKG+NV +VL++ G + SGFLG Sbjct: 4 ILTLTLNPALDLTVELARLEPGQVNRSDAMHAHAAGKGVNVAQVLADLGHTLTVSGFLGE 63 Query: 62 ALGQYIEEQIETTRIKQAFFKIKGETRNCIAIL-HEGQQTEILEKGPTIELKESEEFKSH 120 Q E AF ++ GETR+ I + +G+ T++ GP ++ + + Sbjct: 64 DNAQVFETLFAQRGFVDAFIRVPGETRSNIKLAEQDGRITDLNGPGPMVDAAAQQALLAR 123 Query: 121 LLKLFKETDVAVMSGSLPKGLNTDYYADIVRLAKEQGILTILDSSGQSLEEVLISNVKPT 180 L ++ DV V++GSLP+G++ + ++ K G+ LD+SG++L L + P Sbjct: 124 LEQIAPGHDVVVVAGSLPRGVSPQWLQALIARMKALGLNVALDTSGEALRVALAAG--PW 181 Query: 181 VIKPNIDELSQLLNYKVTNDIKELKAAVSQPIFNDIEWIIVSLGSEGAFAKHNQKFYKVN 240 +IKPN +EL+ L +V ++ + +AA + IE +++S G++G + Sbjct: 182 LIKPNTEELADALGCEVVSETAQAQAA-QRLHAQGIEHVVISHGADGVNWFSVGAALHAS 240 Query: 241 IPNIKVVNPVGSGDSTVAGIASGLIHQQTDEELLKKANAFGML 283 P + V + VG+GDS +AG+ GL+ T E+ L+ A A + Sbjct: 241 PPKVSVASTVGAGDSLLAGMLHGLLSADTPEQTLRTATAIAAM 283 Lambda K H 0.314 0.134 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 313 Length adjustment: 27 Effective length of query: 283 Effective length of database: 286 Effective search space: 80938 Effective search space used: 80938 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory