Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate AO356_00010 AO356_00010 ABC transporter ATP-binding protein
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_00010 Length = 365 Score = 313 bits (803), Expect = 4e-90 Identities = 176/376 (46%), Positives = 241/376 (64%), Gaps = 32/376 (8%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M TLK++N+ K + ++ +L++ DKEF+VFVGPSGCGKST LR+IAGLED+T G Sbjct: 1 MATLKIENLKKGFEGLS--IIKGIDLEVKDKEFVVFVGPSGCGKSTLLRLIAGLEDVTSG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 + +D + + + +P RD+AMVFQ YALYPHM+V +N++F L L KK D+ ++V EAA Sbjct: 59 TIELDGRDITEVTPAKRDLAMVFQTYALYPHMTVRKNLSFALDLAGEKKPDVERKVAEAA 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 IL L L+RKP LSGGQRQRVA+GRAIVR+ K+FL DEPLSNLDA LRV R E+++ Sbjct: 119 RILELGSLLDRKPKQLSGGQRQRVAIGRAIVRNPKIFLFDEPLSNLDAALRVQTRLELSR 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +H+ + AT IYVTHDQ EAMTLA ++V+++A GRIEQIG+P ELY+ PAN Sbjct: 179 LHKELQATMIYVTHDQVEAMTLATKVVVLNA----------GRIEQIGSPLELYHHPANL 228 Query: 241 FVAGFIGSPAMNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKG---YLGKKVTLGIRP 297 FVAGF+G+P M F + TV V+ G+ + G ++ +G+ VT+GIRP Sbjct: 229 FVAGFLGTPKMGFLQATV---HAVHASGVEVRFASGTTLLIPRDSSALSVGQSVTIGIRP 285 Query: 298 EDI---SSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTE-FTARVNARDSHSPG 353 E + + Q++ VT D V+E LGS++ +V S E T RV Sbjct: 286 EHLTLGAEGQVL--------VTTD--VTERLGSDTFCHVNVDSGESLTVRVQGDCEVPYA 335 Query: 354 EKVQLTFNIAKGHFFD 369 + LT ++A H FD Sbjct: 336 ARRYLTLDVAHCHLFD 351 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 345 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 365 Length adjustment: 30 Effective length of query: 347 Effective length of database: 335 Effective search space: 116245 Effective search space used: 116245 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory