Align Inositol transport ATP-binding protein IatA, component of The myoinositol (high affinity)/ D-ribose (low affinity) transporter IatP/IatA/IbpA. The structure of IbpA with myoinositol bound has been solved (characterized)
to candidate AO356_28510 AO356_28510 xylose transporter
Query= TCDB::B8H229 (515 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_28510 Length = 518 Score = 332 bits (852), Expect = 2e-95 Identities = 196/499 (39%), Positives = 306/499 (61%), Gaps = 7/499 (1%) Query: 3 LLDVSQVSKSFPGVRALDQVDLVVGVGEVHALLGENGAGKSTLIKILSAA--HAADAGTV 60 LL ++ + K+F GV+AL+ +D+ V GE L GENGAGKSTL+K+LSA H G + Sbjct: 5 LLQMNGIVKTFGGVKALNGIDIKVRPGECVGLCGENGAGKSTLMKVLSAVYPHGTWEGEI 64 Query: 61 TFAGQVLDPRDAPLRRQQLGIATIYQEFNLFPELSVAENMYLGREPRRLG-LVDWSRLRA 119 + GQ L + + GI I+QE L P+LSVAEN+++G E G +++ + Sbjct: 65 IWDGQPLKAQSIS-ETEAAGIVIIHQELTLVPDLSVAENIFMGHELTLPGGRMNYPAMIH 123 Query: 120 DAQALLNDLGLP-LNPDAPVRGLTVAEQQMVEIAKAMTLNARLIIMDEPTAALSGREVDR 178 A+AL+ +L +P +N PV QQ+VEIAKA+ ARL+I+DEP++AL+ E++ Sbjct: 124 RAEALMRELKVPDMNVSLPVSQYGGGYQQLVEIAKALNKQARLLILDEPSSALTRSEIEV 183 Query: 179 LHAIIAGLKARSVSVIYVSHRLGEVKAMCDRYTVMRDGRFVASGDVADVEVADMVRLMVG 238 L II LKA+ V+ +Y+SH+L EV A+CD +V+RDG+ +A+ + D+++ ++ MVG Sbjct: 184 LLDIIRDLKAKGVACVYISHKLDEVAAVCDTISVIRDGKHIATTAMTDMDIPKIITQMVG 243 Query: 239 RHVEFERRKRRRPPGAVVLKVEGVTPAAPRLSAPGYLRQVSFAARGGEIVGLAGLVGAGR 298 R + G V+ + VT + +SF + GEI+G+AGLVGAGR Sbjct: 244 REMSNLYPTEPHDIGEVIFEARHVTCYDVDNPRRKRVDDISFVLKRGEILGIAGLVGAGR 303 Query: 299 TDLARLIFGADPIA-AGRVLVDDKPLRLRSPRDAIQAGIMLVPEDRKQQGCFLDHSIRRN 357 T+L +FGA P G V ++ + + R+P +I+AG+ +VPEDRK+QG D + +N Sbjct: 304 TELVSALFGAYPGRYEGEVWLNGQQIDTRTPLKSIRAGLCMVPEDRKRQGIIPDLGVGQN 363 Query: 358 LSLPSLKALSALGQWVDERAERDLVETYRQKLRIKMADAETAIGKLSGGNQQKVLLGRAM 417 ++L L S L + +D AE ++ ++ +K A I LSGGNQQK +L + + Sbjct: 364 ITLAVLDNYSKLTR-IDAEAELGSIDKEIARMHLKTASPFLPITSLSGGNQQKAVLAKML 422 Query: 418 ALTPKVLIVDEPTRGIDIGAKAEVHQVLSDLADLGVAVVVISSELAEVMAVSDRIVVFRE 477 P+VLI+DEPTRG+D+GAK E+++++ LA GV+++++SSELAEV+ VSDR++V + Sbjct: 423 LTKPRVLILDEPTRGVDVGAKYEIYKLMGALAAEGVSIIMVSSELAEVLGVSDRVLVIGD 482 Query: 478 GVIVADLDAQTATEEGLMA 496 G + D T+E ++A Sbjct: 483 GQLRGDFINHELTQEQVLA 501 Lambda K H 0.320 0.136 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 662 Number of extensions: 39 Number of successful extensions: 11 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 515 Length of database: 518 Length adjustment: 35 Effective length of query: 480 Effective length of database: 483 Effective search space: 231840 Effective search space used: 231840 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory