Align sorbitol-6-phosphate dehydrogenase subunit (EC 1.1.1.140) (characterized)
to candidate AO356_23595 AO356_23595 short-chain dehydrogenase
Query= metacyc::MONOMER-13092 (266 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_23595 Length = 254 Score = 111 bits (277), Expect = 2e-29 Identities = 84/263 (31%), Positives = 130/263 (49%), Gaps = 29/263 (11%) Query: 7 IAGKTVIVTGASSGIGKAIVDELLSLKVKVANFDLTDNGEKHE----NLLFQKVDVTSRE 62 + GK +VTGA+SGIGKAI L KV D+ N HE L+ + D+T+ Sbjct: 12 VQGKVALVTGAASGIGKAIALLLHVRGAKVIAEDI--NPAVHELARPGLVPLEADITADG 69 Query: 63 QVEASVAAVVEHFGTVDAVVNNAGINIPRLLVDPKDPHGQYELDDATFEKITMINQKGLY 122 E +V VE FG +D +VNNAGI I +L++D + +E+I +N + Sbjct: 70 AAERAVGLAVEQFGRLDILVNNAGIIINKLVID---------MTRQDWERIQAVNATAAF 120 Query: 123 LVSQAVGRLLVAKKKGVIINMASEAGLEGSEGQSAYAGTKAAVYSYTRSWAKELGKYGVR 182 L S+ + ++ K G I+N+AS A +AY +K A+ TR+ A E+ ++G+R Sbjct: 121 LHSREAVKAMMPNKAGAIVNIASYASYFAFPTIAAYTASKGALAQLTRTLALEVIEHGIR 180 Query: 183 VVGIAPGIMEATGLRTLAYEEALGYTRGKTVEEIRAGYAS-TTTTPLGRSGKLSEVADLV 241 V I G + L + VE+ A A P+GR+ + E+A++V Sbjct: 181 VNAIGVGDVVTNILNDV-------------VEDGPAFLAQHGEAAPIGRAAQPEEIAEVV 227 Query: 242 AYYISDRSSYITGITTNVAGGKT 264 A+ SDR+S++ G GG T Sbjct: 228 AFLASDRASFVVGAVVMADGGMT 250 Lambda K H 0.313 0.131 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 254 Length adjustment: 24 Effective length of query: 242 Effective length of database: 230 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory