Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate AO356_27920 AO356_27920 p-hydroxycinnamoyl CoA hydratase/lyase
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_27920 Length = 276 Score = 140 bits (352), Expect = 4e-38 Identities = 78/218 (35%), Positives = 121/218 (55%), Gaps = 5/218 (2%) Query: 3 FETIETKKEGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFC 62 ++T++ E + W+TLNRP+K NA++ L E+ + E DP V+++TG G A+ Sbjct: 8 WKTVKVDIEEGIAWVTLNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGDAWT 67 Query: 63 AGADITQFNQLTPAEAWKFSKKGREIMDK-----IEALSKPTIAMINGYALGGGLELALA 117 AG D+ ++ + A +K R + + +KPTIAM+NG+ GGG +A Sbjct: 68 AGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVA 127 Query: 118 CDIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGL 177 CD+ I A+EA GL EIN GI PG ++ + +G ++L +MTG G+ A + GL Sbjct: 128 CDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGL 187 Query: 178 VNRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNR 215 VN VPLA L + T +LA + +K+P+ L K R Sbjct: 188 VNESVPLAQLREVTVELARNLLEKNPVVLRAAKHGFKR 225 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 2 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 276 Length adjustment: 25 Effective length of query: 234 Effective length of database: 251 Effective search space: 58734 Effective search space used: 58734 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory