Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate AO356_23210 AO356_23210 ABC transporter
Query= TCDB::G4FGN4 (313 letters) >FitnessBrowser__pseudo5_N2C3_1:AO356_23210 Length = 340 Score = 222 bits (566), Expect = 9e-63 Identities = 130/320 (40%), Positives = 188/320 (58%), Gaps = 22/320 (6%) Query: 10 EAGIFLILIAI-VVF--LGVTTRE---FLTVENIFTVILNVSFIAIMSFGMTMVIITSGI 63 E IFL+LI I +VF G R+ + + + +IL VS I +++ G+T VIIT+GI Sbjct: 23 ELSIFLVLIGIGLVFEMFGWIMRDQSFLMNSQRLVLMILQVSIIGLLAIGVTQVIITTGI 82 Query: 64 DLSVGSILGAASVVMGLLMDEKG-----------LSPFLSVVIGLAVGVGFGLANGLLIT 112 DLS GS+L ++++ L L ++ VV GL VG+ G NG +I Sbjct: 83 DLSSGSVLALSAMIAASLAQTSDFARAVFPSLTDLPVWIPVVAGLGVGLLAGAINGSIIA 142 Query: 113 KARLAPFISTLGMLSVGRGLAYVMSGGWPISPFPESFTVHGQGMVGPVPVPVIYMAVIGV 172 + PFI+TLGM+ RGLA + G P+S +S+T G G + PVI V+ V Sbjct: 143 ITGIPPFIATLGMMVSARGLARYYTEGQPVSMLSDSYTAIGHGAM-----PVIIFLVVAV 197 Query: 173 IAHIFLKYTVTGRRIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGV 232 I HI L+YT G+ YAIGGNM+A++ GI R L++VY+I G LA AG + +A Sbjct: 198 IFHIALRYTKYGKYTYAIGGNMQAARTSGINVKRHLVIVYSIAGLLAGLAGVVASARAAT 257 Query: 233 AQPNAGQGYELDVIAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQV 292 Q G YELD IAA VIGGTSL+GG G I G +GA+I+GV+ +G +GV ++ Q + Sbjct: 258 GQAGMGMSYELDAIAAAVIGGTSLAGGVGRITGTVIGALILGVMASGFTFVGVDAYIQDI 317 Query: 293 VIGIVIIIAIAIDQIRRAKE 312 + G++I++A+ IDQ R ++ Sbjct: 318 IKGLIIVVAVVIDQYRNKRK 337 Lambda K H 0.328 0.145 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 340 Length adjustment: 28 Effective length of query: 285 Effective length of database: 312 Effective search space: 88920 Effective search space used: 88920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory