Align crotonase (EC 4.2.1.150) (characterized)
to candidate 642684568 Cphamn1_2077 1,4-Dihydroxy-2-naphthoyl-CoA synthase (EC 4.1.3.36)
Query= metacyc::MONOMER-13469 (259 letters) >IMG__ChlphaBS1_FD:642684568 Length = 273 Score = 141 bits (355), Expect = 2e-38 Identities = 93/261 (35%), Positives = 138/261 (52%), Gaps = 11/261 (4%) Query: 2 EFKNIILEKDGNVASITLNRPKALNALNAATLKEIDAAINDIAEDDNVYAVIITGSGK-A 60 +F +I K +A IT+NRP+ NA T+ E+ A+ + D+N+ +I+TG G A Sbjct: 11 DFTDIFYHKADGIAKITINRPERRNAFRPQTVVEMIQALENARNDENIGVIILTGQGPLA 70 Query: 61 FVAGADIAEMKDLTAVEGRKFSVLGNKIF-RKLENLEKPVIAAINGFALGGGCELSLSCD 119 F +G D D + + + L F R + KPVIA + G+A+GGG L + CD Sbjct: 71 FCSGGDQKIRGDAGYADEKGVNRLNVLDFQRNIRTCPKPVIAMVAGYAIGGGHVLHMLCD 130 Query: 120 IRIASSKAKFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVN 179 + IA+ A FGQ +G G G +AR +G A+E+ Y + NA+EAL +GLVN Sbjct: 131 LTIAAENAVFGQTGPKVGSFDGGWGASYMARLVGQKKAREIWYLCRQYNAQEALDMGLVN 190 Query: 180 KVVEPDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFGEC---- 235 VV D+L EE I+ ++P+A+R K+A+N CD G+ E+ G Sbjct: 191 TVVPLDRLEEETVQWCREILQHSPLAIRCLKSALN--ADCDGQAGL---QELAGNATLLY 245 Query: 236 FATEDRVEGMTAFVEKRDKAF 256 + +E+ EG AFVEKR F Sbjct: 246 YMSEEAQEGKNAFVEKRKPDF 266 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 273 Length adjustment: 25 Effective length of query: 234 Effective length of database: 248 Effective search space: 58032 Effective search space used: 58032 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory