Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate 642684602 Cphamn1_2111 short chain enoyl-CoA hydratase (EC 4.2.1.17)
Query= BRENDA::A4YI89 (259 letters) >IMG__ChlphaBS1_FD:642684602 Length = 265 Score = 146 bits (369), Expect = 4e-40 Identities = 94/261 (36%), Positives = 138/261 (52%), Gaps = 9/261 (3%) Query: 4 ETIETKK-EGNLFWITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFC 62 ET+ KK E + IT+NRP NAL+ + +E L RA+ +D +RVII+ G GK FC Sbjct: 9 ETVLIKKDEHEIGHITINRPKAYNALSIECMEALIRALDILSADSSVRVIILAGSGKGFC 68 Query: 63 AGADITQFNQLTPAEAWKFSKK----GREIMDKIEALSKPTIAMINGYALGGGLELALAC 118 AG D+ + T F KK +M I KP IA ++G A G +L +C Sbjct: 69 AGHDLKELRSCTEKT---FHKKIFDLCTRLMLSITRSPKPVIAKVHGIATAAGCQLVASC 125 Query: 119 DIRIAAEEAQLGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLV 178 D+ +A + A P + +G++ L+R I K A+EM+++GD I + A + GL+ Sbjct: 126 DLAVAEKNAGFATPGVTIGLFCSTPMVA-LSRNISKKHAMEMLLSGDLISAQRAYETGLI 184 Query: 179 NRVVPLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALESVGWGVVFST 238 NR+VP+ L+Q T LA+KIA KSP++L + K LD S ++ Sbjct: 185 NRLVPIEQLDQATLDLAKKIASKSPLALKIGKRAFYEQLDRNEEDAYRYCSQVMVENLTS 244 Query: 239 EDKKEGVSAFLEKREPTFKGK 259 D KEG+ A LEKR P + G+ Sbjct: 245 RDAKEGIDAVLEKRSPVWCGE 265 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 138 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 265 Length adjustment: 25 Effective length of query: 234 Effective length of database: 240 Effective search space: 56160 Effective search space used: 56160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory