Protein WP_010932143.1 in Chlorobaculum tepidum TLS
Annotation: NCBI__GCF_000006985.1:WP_010932143.1
Length: 237 amino acids
Source: GCF_000006985.1 in NCBI
Candidate for 29 steps in catabolism of small carbon sources
Pathway | Step | Score | Similar to | Id. | Cov. | Bits | Other hit | Other id. | Other bits |
L-asparagine catabolism | aatP | med | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 40% | 86% | 144.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-aspartate catabolism | aatP | med | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 40% | 86% | 144.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-glutamate catabolism | gltL | med | Glutamate/aspartate transport ATP-binding protein GltL aka B0652, component of Glutamate/aspartate porter (characterized) | 40% | 86% | 144.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-histidine catabolism | hutV | med | ABC transporter for L-Histidine, ATPase component (characterized) | 40% | 75% | 129.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
sucrose catabolism | thuK | lo | ABC transporter (characterized, see rationale) | 38% | 57% | 145.2 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
putrescine catabolism | potA | lo | spermidine/putrescine ABC transporter, ATP-binding protein PotA; EC 3.6.3.31 (characterized) | 39% | 58% | 140.6 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
N-acetyl-D-glucosamine catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 38% | 61% | 137.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-glucosamine (chitosamine) catabolism | SMc02869 | lo | N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) | 38% | 61% | 137.1 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-asparagine catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 38% | 76% | 134.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-aspartate catabolism | bztD | lo | BztD, component of Glutamate/glutamine/aspartate/asparagine porter (characterized) | 38% | 76% | 134.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-cellobiose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 36% | 63% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-glucose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 36% | 63% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
lactose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 36% | 63% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-maltose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 36% | 63% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
sucrose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 36% | 63% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
trehalose catabolism | gtsD | lo | Sugar ABC transporter ATP-binding protein (characterized, see rationale) | 36% | 63% | 134 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
trehalose catabolism | treV | lo | TreV, component of Trehalose porter (characterized) | 39% | 64% | 131.7 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-asparagine catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 84% | 131.3 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-aspartate catabolism | peb1C | lo | PEB1C, component of Uptake system for glutamate and aspartate (characterized) | 38% | 84% | 131.3 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-galactose catabolism | PfGW456L13_1897 | lo | ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) | 35% | 57% | 129.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-xylose catabolism | gtsD | lo | ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) | 34% | 57% | 127.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-maltose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 37% | 62% | 124.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
trehalose catabolism | thuK | lo | ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized) | 37% | 62% | 124.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-maltose catabolism | malK_Bb | lo | ABC-type maltose transport, ATP binding protein (characterized, see rationale) | 35% | 59% | 124 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
L-proline catabolism | hutV | lo | HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized) | 36% | 79% | 122.9 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-maltose catabolism | malK_Sm | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 32% | 57% | 119.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
trehalose catabolism | malK | lo | MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized) | 32% | 57% | 119.8 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
D-mannose catabolism | TM1750 | lo | TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized) | 32% | 70% | 114.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
glycerol catabolism | glpS | lo | ABC transporter for Glycerol, ATPase component 1 (characterized) | 33% | 55% | 109.4 | lipoprotein releasing system, ATP-binding protein; EC 3.6.3.- | 46% | 208.8 |
Sequence Analysis Tools
View WP_010932143.1 at NCBI
Find papers: PaperBLAST
Find functional residues: SitesBLAST
Search for conserved domains
Find the best match in UniProt
Compare to protein structures
Predict transmenbrane helices: Phobius
Predict protein localization: PSORTb
Find homologs in fast.genomics
Fitness BLAST: loading...
Sequence
MAETILRLKGIRKELELSRDVRQTILPNLSLEIFEGEFVAITGPSGSGKSTLLYIMGGLD
KPTFGKVWLDGQEITGLDEAEMTVIRNRKIGFIYQFHFLLPEFSAVDNVMMPMLIRRKYG
KKEIRERAMKLLDMVGLEDKYTNKPNQLSGGQQQRVAIARALANEPKVLLGDEPTGNLDS
RSANNVYELFARLNCELNQTVIVVTHDEDFANRAGRRIHLVDGKIESDSRTPRQATA
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Links
Downloads
Related tools
About GapMind
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using
ublast (a fast alternative to protein BLAST)
against a database of manually-curated proteins (most of which are experimentally characterized) or by using
HMMer with enzyme models (usually from
TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
- ublast finds a hit to a characterized protein at above 40% identity and 80% coverage, and bits >= other bits+10.
- (Hits to curated proteins without experimental data as to their function are never considered high confidence.)
- HMMer finds a hit with 80% coverage of the model, and either other identity < 40 or other coverage < 0.75.
where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").
Otherwise, a candidate is "medium confidence" if either:
- ublast finds a hit at above 40% identity and 70% coverage (ignoring otherBits).
- ublast finds a hit at above 30% identity and 80% coverage, and bits >= other bits.
- HMMer finds a hit (regardless of coverage or other bits).
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps."
For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways.
For diverse bacteria and archaea that can utilize a carbon source, there is a complete
high-confidence catabolic pathway (including a transporter) just 38% of the time, and
there is a complete medium-confidence pathway 63% of the time.
Gaps may be due to:
- our ignorance of proteins' functions,
- omissions in the gene models,
- frame-shift errors in the genome sequence, or
- the organism lacks the pathway.
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory