GapMind for catabolism of small carbon sources

 

Protein WP_011020381.1 in Methanosarcina acetivorans C2A

Annotation: NCBI__GCF_000007345.1:WP_011020381.1

Length: 353 amino acids

Source: GCF_000007345.1 in NCBI

Candidate for 33 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
D-mannitol catabolism mtlK lo MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 37% 80% 198.7 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-sorbitol (glucitol) catabolism mtlK lo MtlK, component of The polyol (mannitol, glucitol (sorbitol), arabitol (arabinitol; lyxitol)) uptake porter, MtlEFGK (characterized) 37% 80% 198.7 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-maltose catabolism malK1 lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 86% 194.5 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
trehalose catabolism thuK lo MalK; aka Sugar ABC transporter, ATP-binding protein, component of The maltose, maltotriose, mannotetraose (MalE1)/maltose, maltotriose, trehalose (MalE2) porter (Nanavati et al., 2005). For MalG1 (823aas) and MalG2 (833aas), the C-terminal transmembrane domain with 6 putative TMSs is preceded by a single N-terminal TMS and a large (600 residue) hydrophilic region showing sequence similarity to MLP1 and 2 (9.A.14; e-12 & e-7) as well as other proteins (characterized) 34% 86% 194.5 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
lactose catabolism lacK lo ABC transporter for Lactose, ATPase component (characterized) 36% 92% 191.4 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
L-fucose catabolism SM_b21106 lo ABC transporter for L-Fucose, ATPase component (characterized) 33% 87% 190.7 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-cellobiose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-glucose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
lactose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-maltose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-maltose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-mannose catabolism TT_C0211 lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
sucrose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
sucrose catabolism thuK lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
trehalose catabolism gtsD lo Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized) 34% 82% 188.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-xylose catabolism gtsD lo ABC transporter for D-Glucose-6-Phosphate, ATPase component (characterized) 31% 89% 187.6 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-galactose catabolism PfGW456L13_1897 lo ABC transporter for D-Galactose and D-Glucose, ATPase component (characterized) 32% 89% 186 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-maltose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 90% 185.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
sucrose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 90% 185.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
trehalose catabolism aglK lo ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized) 34% 90% 185.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
xylitol catabolism HSERO_RS17020 lo ABC-type sugar transport system, ATPase component protein (characterized, see rationale) 34% 67% 179.5 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-maltose catabolism malK_Bb lo ABC-type maltose transport, ATP binding protein (characterized, see rationale) 37% 71% 177.9 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
N-acetyl-D-glucosamine catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 73% 175.6 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-glucosamine (chitosamine) catabolism SMc02869 lo N-Acetyl-D-glucosamine ABC transport system, ATPase component (characterized) 37% 73% 175.6 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
trehalose catabolism treV lo TreV, component of Trehalose porter (characterized) 38% 77% 173.3 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-cellobiose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 77% 171.8 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-glucose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 77% 171.8 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
lactose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 77% 171.8 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
D-maltose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 77% 171.8 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
sucrose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 77% 171.8 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
trehalose catabolism aglK' lo Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale) 36% 77% 171.8 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
glycerol catabolism glpT lo ABC transporter for Glycerol, ATPase component 2 (characterized) 31% 87% 149.8 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5
L-arabinose catabolism xylGsa lo Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale) 33% 87% 119.4 Molybdenum ABC transporter, ATP-binding protein, component of The molybdate/tungstate ABC transporter, ModABC. The trans-inhibited 3-d structure of ModABC, is available (3D31.A and 3D31.B)(Gerber et al., 2008) 100% 684.5

Sequence Analysis Tools

View WP_011020381.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MSFLEVRDIYLDVGSFELKGIDLRAEKGDYVALIGPSGSGKSLLLETIIGFYGPRQGSVF
LEGRDITFFSPDKRQISIVYQDNMLFPHMDIFENIAYALRKKLKDKKQIELEVTQIAGVL
GIRELLHRKPDTLSGGEKQRASLARSLVARPKLLLLDEPFSALDARTREKLREMLKKAIA
DYSTTVLHVTHDFEDVWALANRVVVIRKGEVMQVGDPESVFRRPSPDFVAEFLGTNVLKG
TVKALEGKLTVIDAEGMEIYSADPAEPGENVTVSIRPEEIILAGGTVESSARNTLKGRVS
GIFKKEHLVVVEVKMGNSEIKAVVTPTSCEMLGIEPGREMYAVFKASNARIIR

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory