Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate WP_011020641.1 MA_RS03105 phosphoglycerate dehydrogenase
Query= BRENDA::F8A9V0 (325 letters) >NCBI__GCF_000007345.1:WP_011020641.1 Length = 523 Score = 148 bits (373), Expect = 3e-40 Identities = 89/289 (30%), Positives = 156/289 (53%), Gaps = 21/289 (7%) Query: 19 ILPSDWDVEMTPDFLDETTVEKAKGAQVVSLFVSDKADGPVLEALHSYGVGLLALRSAGY 78 IL + V++ ++ VEK + + + V+EA + + ++ G Sbjct: 16 ILKEHFTVDVNTGLSEDELVEKIGEYDALVIRSGTQVTQRVIEAADN--LKIVGRAGVGV 73 Query: 79 DHIDIETAKRLGIKVVNVPAYSPHAIADHTLAIMLALIRRLHRAHDKVRLGDFDLDGLMG 138 D++D++ A + GI V N P + + A+HT+ +M+A+ R + +A+ ++ ++ + MG Sbjct: 74 DNVDVDAATKKGIIVANAPEGNMISAAEHTIGMMMAMSRNIPQANASLKGREWKRNKFMG 133 Query: 139 FDLNGKVAGVIGLGKIGRLVATRLKAFGCKVLGYDPYIQPEI-----VENVDLDTLITQA 193 ++ GK G+IGLG+IG VA R ++GYDP+I + V+ ++ + +A Sbjct: 134 VEVKGKTLGIIGLGRIGSEVAKRASGLEMNLMGYDPFISEKRAMELGVKLATVNEISKEA 193 Query: 194 DIISIHCPLTRENFHMFNEETFKRMKPGAILVNTARGGLIDTKALLEALKSGKLGGAALD 253 D I++H PL +E ++ ++E F MK G ++N ARGG+I+ AL+ AL+SGK+GGAALD Sbjct: 194 DYITVHTPLIKETRNILDDEQFDLMKSGVRILNCARGGIINEAALVRALESGKVGGAALD 253 Query: 254 VYEYERGLFFKNHQKEGIKDPYLAQLLGLANVVLTGHQAFLTREAVKNI 302 V+ E P+ + LL NV++T H T+EA N+ Sbjct: 254 VFVEE--------------PPFGSPLLNFDNVIVTPHLGASTQEAQVNV 288 Lambda K H 0.321 0.140 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 325 Length of database: 523 Length adjustment: 31 Effective length of query: 294 Effective length of database: 492 Effective search space: 144648 Effective search space used: 144648 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory