GapMind for catabolism of small carbon sources

 

Alignments for a candidate for glmS in Methanosarcina acetivorans C2A

Align Glutamate mutase sigma subunit; Glutamate mutase S chain; Glutamate mutase small subunit; Methylaspartate mutase; EC 5.4.99.1 (characterized)
to candidate WP_011022395.1 MA_RS12580 dimethylamine corrinoid protein MtbC

Query= SwissProt::Q05488
         (137 letters)



>NCBI__GCF_000007345.1:WP_011022395.1
          Length = 213

 Score = 49.7 bits (117), Expect = 3e-11
 Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 2   EKK--TIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLIC 59
           EKK   IV G +  D H +G  I+     +AGF V +IG      DFI  A ET AD+I 
Sbjct: 88  EKKLGVIVNGTVEGDVHDIGKSIVSTMLQSAGFEVHDIGRDVPIRDFIEKAKETDADMIG 147

Query: 60  VSSLYGQGEIDCKGLREKCDEAGLKG-IKLFVGGNIVVGKQNWPD 103
           +S+L        + + E   E GL+  +K+ VGG      Q W D
Sbjct: 148 ISALMTTTLQGQRDVIELLKEEGLRSRVKVMVGG--APATQAWAD 190


Lambda     K      H
   0.318    0.138    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 101
Number of extensions: 6
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 137
Length of database: 213
Length adjustment: 18
Effective length of query: 119
Effective length of database: 195
Effective search space:    23205
Effective search space used:    23205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 43 (21.2 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory