Align Glutamate mutase sigma subunit; Glutamate mutase S chain; Glutamate mutase small subunit; Methylaspartate mutase; EC 5.4.99.1 (characterized)
to candidate WP_011022395.1 MA_RS12580 dimethylamine corrinoid protein MtbC
Query= SwissProt::Q05488 (137 letters) >NCBI__GCF_000007345.1:WP_011022395.1 Length = 213 Score = 49.7 bits (117), Expect = 3e-11 Identities = 38/105 (36%), Positives = 51/105 (48%), Gaps = 5/105 (4%) Query: 2 EKK--TIVLGVIGSDCHAVGNKILDHSFTNAGFNVVNIGVLSSQEDFINAAIETKADLIC 59 EKK IV G + D H +G I+ +AGF V +IG DFI A ET AD+I Sbjct: 88 EKKLGVIVNGTVEGDVHDIGKSIVSTMLQSAGFEVHDIGRDVPIRDFIEKAKETDADMIG 147 Query: 60 VSSLYGQGEIDCKGLREKCDEAGLKG-IKLFVGGNIVVGKQNWPD 103 +S+L + + E E GL+ +K+ VGG Q W D Sbjct: 148 ISALMTTTLQGQRDVIELLKEEGLRSRVKVMVGG--APATQAWAD 190 Lambda K H 0.318 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 101 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 137 Length of database: 213 Length adjustment: 18 Effective length of query: 119 Effective length of database: 195 Effective search space: 23205 Effective search space used: 23205 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory