Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011023914.1 MA_RS20975 ATP-binding cassette domain-containing protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000007345.1:WP_011023914.1 Length = 326 Score = 99.8 bits (247), Expect = 6e-26 Identities = 77/250 (30%), Positives = 133/250 (53%), Gaps = 24/250 (9%) Query: 7 TGQPLLQVNGVETYYGNIRA--LAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQAR 64 +G P+L+V + Y ++ A L +++ V KGE V+++GANGAGKSTL + G + Sbjct: 41 SGIPILEVKNLCHRYPHLDANTLEEINLKVYKGERVAVLGANGAGKSTLFKHLNGILKPL 100 Query: 65 TGSVVFEGRDITRMPTHEIARLR--IAQSPEGRRIFPRMTVLENLQMGAGLDNLKHFAED 122 +G V+ +G IT+ + Q P+ + + P +V E++ G N+ +E+ Sbjct: 101 SGEVLVKGEKITKKNVRMCRETVGIVFQDPDDQVLAP--SVEEDIAFGP--INMGLSSEE 156 Query: 123 VEKIFTLFPRLKERHAQRG---------GTLSGGEQQMLSIGRALMARPKLLLLDEPSLG 173 VEK R+KE G LSGG++++++I L RP++++LDEP+ G Sbjct: 157 VEK------RVKEALKMVGLEGFEERAPHHLSGGQKKLVAIAGILAMRPEVIVLDEPTAG 210 Query: 174 LAPLIVKGIFEAIRKLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLA 233 L PL E I K+N+ G+T+ L + + R +V+ +GK+ G +E+ + Sbjct: 211 LDPLSSARFLELIMKMNKELGITLLLSTHDVDVVPYFAERVFVLHHGKLEADGIPEEIFS 270 Query: 234 NPE-VRAAYL 242 +PE +R A+L Sbjct: 271 DPELLRKAHL 280 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 225 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 326 Length adjustment: 26 Effective length of query: 221 Effective length of database: 300 Effective search space: 66300 Effective search space used: 66300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory