Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_011020340.1 MA_RS01500 ATP-binding cassette domain-containing protein
Query= reanno::Phaeo:GFF1302 (334 letters) >NCBI__GCF_000007345.1:WP_011020340.1 Length = 348 Score = 185 bits (470), Expect = 1e-51 Identities = 101/235 (42%), Positives = 146/235 (62%), Gaps = 10/235 (4%) Query: 4 IKLESVT---KNFGPVEVIPPLDLTIEDGEFTVFVGPSGCGKSTLLRLIAGLEDITSGTI 60 I++ES++ KNF + L L +E GE+ V +GP+G GK+ L LIAG SG I Sbjct: 2 IEIESLSRKWKNFS----LDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRI 57 Query: 61 RIDGEDATNIPPAKRGLAMVFQSYALYPHMSVRKNIAFPMKMAGIPADEQKRRIDNAAAA 120 +DG+D T++ P K +A V+Q+Y+L+PHM+V+KN+ F M+M I + +R+ + A Sbjct: 58 LLDGKDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKI---KDPKRVLDTARD 114 Query: 121 LNLTDYLDRRPGQLSGGQRQRVAIGRAIVREPAAFLFDEPLSNLDAALRVGMRLEISELH 180 L + LDR P LSGG++QRVA+ RA+V P L DEPLS LD + R +S LH Sbjct: 115 LKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLH 174 Query: 181 KRLATTMIYVTHDQVEAMTMADKIVVLQAGVIEQVGSPMELYRAPRNVFVAGFIG 235 K+ T++++THDQ EA MAD+I V+ G + QVG P E++ P VA F+G Sbjct: 175 KKNKLTVLHITHDQTEARIMADRIAVVMDGKLIQVGKPEEIFEKPVEGRVASFVG 229 Lambda K H 0.320 0.138 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 261 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 334 Length of database: 348 Length adjustment: 29 Effective length of query: 305 Effective length of database: 319 Effective search space: 97295 Effective search space used: 97295 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory