Align ABC transporter for D-Sorbitol, ATPase component (characterized)
to candidate WP_011022261.1 MA_RS11835 ABC transporter ATP-binding protein
Query= reanno::BFirm:BPHYT_RS16095 (369 letters) >NCBI__GCF_000007345.1:WP_011022261.1 Length = 383 Score = 175 bits (443), Expect = 2e-48 Identities = 116/351 (33%), Positives = 183/351 (52%), Gaps = 31/351 (8%) Query: 8 NIRKAYDENEVMRD------INLDIA---DGEFVVFVGPSGCGKSTLMRMIAGLEDISGG 58 +I+K Y E E+ R LD++ D E VV GPSG GK+TL + I+G+ G Sbjct: 8 DIKKHYTEAEINRKRSTGKAFTLDVSFEMDNELVVLFGPSGSGKTTLFKCISGITQPDNG 67 Query: 59 DLTI------DGMRVNDVAPAKRGIAMVFQSYALYPHMTLYDNMAFGLKLAGTKKPEIDA 112 +T+ D + ++ KR + VFQ+Y L+PHM + N+ GLK +K + + Sbjct: 68 KITVGSKIYYDKDKKINLPIQKRNLGYVFQNYTLFPHMNVRKNIECGLKK--WEKEDREV 125 Query: 113 AVRNAAKILHIDHLLDRKPKQLSGGQRQRVAIGRAITRKPKVFLFDEPLSNLDAALRVKM 172 V +LHI+ L P QLSGGQ+QRVA+ RA+ KP++ L DEP S LD LR+++ Sbjct: 126 RVMEMLNLLHIEELETHYPSQLSGGQKQRVALARALAPKPELLLLDEPFSALDRVLRIEL 185 Query: 173 RLEFARLHDELKTTMIYVTHDQVEAMTLADKIVVLSAGNLEQVGSPTMLYHAPANRFVAG 232 + +L + + ++TH EA LAD+I++L G ++Q G+P +++ P N VA Sbjct: 186 AEKLKKLQKRIGIPLAFITHSLDEAFVLADRILILYRGEVQQFGAPEEIFYHPRNLHVAE 245 Query: 233 FIGSPKM-------NFMEGVVQSVTHDGVTVRYETGETQRVAVEPAAVKQGDKVTVGIRP 285 G + +E +V+ ++GE R+AV P +K+GDKV+ GI P Sbjct: 246 LAGLSNIFDDARVEEQVEKLVEGNNAGPKRTVLKSGE-MRIAVNPLNLKEGDKVSWGIHP 304 Query: 286 EHLHVGMAEDGISARTMAVESLGDAAYLYAESSVAPDGLIARIPPLERHTK 336 E++ + + G + V S AY+++ + P I + L RH K Sbjct: 305 ENITLLLPNSGSEDKDENVYS----AYVHSITGKGPKKRI--VLKLARHEK 349 Lambda K H 0.320 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 343 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 383 Length adjustment: 30 Effective length of query: 339 Effective length of database: 353 Effective search space: 119667 Effective search space used: 119667 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory