Align Sugar-binding transport ATP-binding protein aka MalK1 aka TT_C0211, component of The trehalose/maltose/sucrose/palatinose porter (TTC1627-9) plus MalK1 (ABC protein, shared with 3.A.1.1.24) (Silva et al. 2005; Chevance et al., 2006). The receptor (TTC1627) binds disaccharide alpha-glycosides, namely trehalose (alpha-1,1), sucrose (alpha-1,2), maltose (alpha-1,4), palatinose (alpha-1,6) and glucose (characterized)
to candidate WP_011020340.1 MA_RS01500 ATP-binding cassette domain-containing protein
Query= TCDB::Q72L52 (376 letters) >NCBI__GCF_000007345.1:WP_011020340.1 Length = 348 Score = 208 bits (530), Expect = 2e-58 Identities = 123/318 (38%), Positives = 185/318 (58%), Gaps = 16/318 (5%) Query: 6 LEHVWKRFGKVVAVKDFNLETEDGEFVVFVGPSGCGKTTTLRMIAGLEEISEGNIYIGDR 65 L WK F ++ + +L+ E GE+ V +GP+G GKT L +IAG G I + + Sbjct: 7 LSRKWKNF----SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDGK 62 Query: 66 LVNDVPPKDRDIAMVFQNYALYPHMNVYENMAFGLRLRRYPKDEIDRRVKEAARILKIEH 125 V D+ P+ DIA V+QNY+L+PHMNV +N+ FG+R+++ KD +RV + AR LKIEH Sbjct: 63 DVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKI-KDP--KRVLDTARDLKIEH 119 Query: 126 LLNRKPRELSGGQRQRVAMGRAIVREPKVFLMDEPLSNLDAKLRVEMRAEIAKLQRRLGV 185 LL+R P LSGG++QRVA+ RA+V PK+ L+DEPLS LD + + R ++ L ++ + Sbjct: 120 LLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKL 179 Query: 186 TTIYVTHDQVEAMTLGHRIVVMKDGEIQQVDTPLNLYDFPANRFVAGFIGSPSMNFVRAG 245 T +++THDQ EA + RI V+ DG++ QV P +++ P VA F+G + V G Sbjct: 180 TVLHITHDQTEARIMADRIAVVMDGKLIQVGKPEEIFEKPVEGRVASFVGFEN---VLKG 236 Query: 246 VEVQGEKVYLVAPGFRIR-ANAVLGSALKPYAGKEVWLGVRPEHLGLKGYTTIPEEENVL 304 + E+ L RIR V+ +A G +V+ +RPE++ L +T N L Sbjct: 237 RVISAEQGLL-----RIRVGEVVIDAAGDMEVGDQVYAFLRPENIALSKSSTQSSIRNSL 291 Query: 305 RGEVEVVEPLGAETEIHV 322 +G V LGA + V Sbjct: 292 QGRVTEAWVLGALVRVKV 309 Lambda K H 0.320 0.139 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 328 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 376 Length of database: 348 Length adjustment: 29 Effective length of query: 347 Effective length of database: 319 Effective search space: 110693 Effective search space used: 110693 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory