Align GtsD (GLcK), component of Glucose porter, GtsABCD (characterized)
to candidate WP_011022261.1 MA_RS11835 ABC transporter ATP-binding protein
Query= TCDB::Q88P35 (384 letters) >NCBI__GCF_000007345.1:WP_011022261.1 Length = 383 Score = 178 bits (451), Expect = 3e-49 Identities = 122/371 (32%), Positives = 190/371 (51%), Gaps = 27/371 (7%) Query: 9 VNKTYGSGLPDTLKDIQLSIKDGEFLILVGPSGCGKSTLMNCIAGLEQITGGAILI---- 64 +N+ +G TL D+ + D E ++L GPSG GK+TL CI+G+ Q G I + Sbjct: 18 INRKRSTGKAFTL-DVSFEM-DNELVVLFGPSGSGKTTLFKCISGITQPDNGKITVGSKI 75 Query: 65 --DEQDVSGMSPKDRDIAMVFQSYALYPTMSVRENIEFGLKIRKLPQAAIDEEVARVAKL 122 D+ + + R++ VFQ+Y L+P M+VR+NIE GLK K + + V + L Sbjct: 76 YYDKDKKINLPIQKRNLGYVFQNYTLFPHMNVRKNIECGLK--KWEKEDREVRVMEMLNL 133 Query: 123 LQIEHLLARKPAQLSGGQQQRVAMGRALARRPKIYLFDEPLSNLDAKLRVEMRTEMKLMH 182 L IE L P+QLSGGQ+QRVA+ RALA +P++ L DEP S LD LR+E+ ++K + Sbjct: 134 LHIEELETHYPSQLSGGQKQRVALARALAPKPELLLLDEPFSALDRVLRIELAEKLKKLQ 193 Query: 183 QRLKTTTVYVTHDQIEAMTLGDKVAVMKDGIIQQFGTPQQIYNDPANQFVASFIGSPPMN 242 +R+ ++TH EA L D++ ++ G +QQFG P++I+ P N VA G + Sbjct: 194 KRIGIPLAFITHSLDEAFVLADRILILYRGEVQQFGAPEEIFYHPRNLHVAELAGLSNI- 252 Query: 243 FIPVRLARQDGRLLALLDSGQARCELPLGEAADAL------EGREIILGIRPEQIAL--- 293 F R+ Q +L+ ++G R L GE A+ EG ++ GI PE I L Sbjct: 253 FDDARVEEQVEKLVEGNNAGPKRTVLKSGEMRIAVNPLNLKEGDKVSWGIHPENITLLLP 312 Query: 294 -GAADGNGLPAIRAEVQVTEPTGPDLLVFVTLNQ------TKVCCRLAPDVACRVGDTLN 346 ++ A V GP + + L + +V + A + GD Sbjct: 313 NSGSEDKDENVYSAYVHSITGKGPKKRIVLKLARHEKSLNAEVPAQFADALNLNTGDLCL 372 Query: 347 LQFDPARVLLF 357 ++ D ++V+ F Sbjct: 373 VKMDMSKVVAF 383 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 383 Length adjustment: 30 Effective length of query: 354 Effective length of database: 353 Effective search space: 124962 Effective search space used: 124962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory