Align L-arabinose 1-dehydrogenase / D-galactose 1-dehydrogenase (EC 1.1.1.46; EC 1.1.1.48) (characterized)
to candidate WP_010960235.1 MCA_RS04555 3-oxoacyl-ACP reductase FabG
Query= reanno::pseudo1_N1B4:Pf1N1B4_412 (272 letters) >NCBI__GCF_000008325.1:WP_010960235.1 Length = 239 Score = 100 bits (248), Expect = 4e-26 Identities = 82/243 (33%), Positives = 115/243 (47%), Gaps = 12/243 (4%) Query: 25 LLTGAAQGIGEAIVATFASQQARLVIS-DIQGEKVEKVAAHWREQGADVVAIKADVSRQQ 83 L++G + GIG AI A + + + E+V R G AI DV Sbjct: 5 LVSGGSGGIGAAICRRLALDGLHVWVHYHGHRQSAEQVVDAIRVGGGSAEAIGFDVC--D 62 Query: 84 DLHAMARLAIELHGR-IDVLVNCAGVNVFRDPLQMTEEDWHRCFAIDLDGAWYGCKAVLP 142 A A +A R I VLVN AG++ M + WHR + L+G + + ++ Sbjct: 63 AAAAAAAIATMCAERPIQVLVNNAGIHDDAVFPAMRSDQWHRVIDVSLNGFFNLTQPLVM 122 Query: 143 QMIEQGIGSIINIASTHSTHIIPGCFPYPVAKHGLLGLTRALGIEYAPKGIRVNAIAPGY 202 MI + G I+NI+S + G Y AK L TR+L +E A +G+ VNA+APG Sbjct: 123 PMIRERWGRIVNISSVAALTGNRGQVNYSAAKGALHSATRSLALELASRGVTVNAVAPGI 182 Query: 203 IETQLNVDYWNGFADPHAERQRAFDLHPPRRIGQPIEVAMTAVFLASDEAPFINASCITI 262 IET G A+ +R L P +R G+P EVA FLASD A +I I+I Sbjct: 183 IET--------GMAESAFDRAAIERLVPMKRAGRPEEVADLVAFLASDRAAYITGQVISI 234 Query: 263 DGG 265 +GG Sbjct: 235 NGG 237 Lambda K H 0.321 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 239 Length adjustment: 24 Effective length of query: 248 Effective length of database: 215 Effective search space: 53320 Effective search space used: 53320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory