Align ABC transporter for D-Cellobiose and D-Salicin, permease component 1 (characterized)
to candidate WP_010961171.1 MCA_RS09425 carbohydrate ABC transporter permease
Query= reanno::Smeli:SMc04257 (305 letters) >NCBI__GCF_000008325.1:WP_010961171.1 Length = 271 Score = 106 bits (265), Expect = 5e-28 Identities = 86/289 (29%), Positives = 139/289 (48%), Gaps = 36/289 (12%) Query: 30 IIVYGTLIVVALYYLLPLYVMIVTSLKGMPEIRVGNIFAPPLEITFEPWVKAWAEACTGL 89 +I Y L + L PL M+ SL MP + PPL W EA T Sbjct: 6 LIFYLVLSLATAATLFPLVWMVSVSL--MPPAEAMR-YPPPL----------WPEAPTLE 52 Query: 90 NCDGL------SRGFWNSV----RITVPSVIISIAIASVNGYALANWRFKGADLFFTILI 139 + L +R NS+ +T PSV+++ A GYA A F G D F +L+ Sbjct: 53 HYRTLFDRLAIARYALNSLVLAGAVTAPSVLVNAAA----GYAFARLPFVGRDALFRLLM 108 Query: 140 VGAFIPYQVMIYPIVIVLREMGVYGTLTGLII--VHTIFGMPILTLLFRNYFAGLPEELF 197 IP QV + P+ ++L+++G+ T G+I+ + +IFG+ L R Y LP+ LF Sbjct: 109 TFMVIPGQVAMLPLFLLLKQLGLINTYAGVIVPGLASIFGI----FLVRQYALSLPQSLF 164 Query: 198 KAARVDGAGFWTIYFKIMLPMSLPIFVVAMILQVTGIWNDFLFG-VVFTRPEYYPMTVQL 256 AAR++GAG I++ ++LP+ PI + + G WNDFL+ +V T + V L Sbjct: 165 DAARLEGAGELRIFWSLVLPLCRPILITLAVFTFLGSWNDFLWPLIVLTDRRLQTLPVAL 224 Query: 257 NNIVNSVQGVKEYNVNMAATILTGLVPLTVYFVSGRLFVRGIAAGAVKG 305 ++ + + + M+ LT + + ++ + R ++ G+ G VKG Sbjct: 225 AALMG--EHAVDTELMMSGAALTVVPVIVLFLAAQRYYLGGLMQGGVKG 271 Lambda K H 0.329 0.145 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 271 Length adjustment: 26 Effective length of query: 279 Effective length of database: 245 Effective search space: 68355 Effective search space used: 68355 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory