Align LacG, component of Lactose porter (characterized)
to candidate WP_010961171.1 MCA_RS09425 carbohydrate ABC transporter permease
Query= TCDB::P29824 (273 letters) >NCBI__GCF_000008325.1:WP_010961171.1 Length = 271 Score = 150 bits (379), Expect = 3e-41 Identities = 82/269 (30%), Positives = 153/269 (56%), Gaps = 3/269 (1%) Query: 8 RLPDIVQYSVLSLAAFLSIFPFIWMVIGTTNTTSQIIRGKVTFG--TALFDNIASFFAQV 65 R P ++ Y VLSLA ++FP +WMV + ++ +R ++ + F ++ Sbjct: 2 RYPALIFYLVLSLATAATLFPLVWMVSVSLMPPAEAMRYPPPLWPEAPTLEHYRTLFDRL 61 Query: 66 DVPLVFWNSVKIALVGTALTLLVSSLAGYGFEMFRSKLRERVYTVILLTLMVPFAALMIP 125 + NS+ +A TA ++LV++ AGY F R+ ++ +++ +++P M+P Sbjct: 62 AIARYALNSLVLAGAVTAPSVLVNAAAGYAFARLPFVGRDALFRLLMTFMVIPGQVAMLP 121 Query: 126 LFMLMGQAGLLNTHIAIMLPMIASAFIIFYFRQASKAFPTELRDAAKVDGLKEWQIFFYI 185 LF+L+ Q GL+NT+ +++P +AS F IF RQ + + P L DAA+++G E +IF+ + Sbjct: 122 LFLLLKQLGLINTYAGVIVPGLASIFGIFLVRQYALSLPQSLFDAARLEGAGELRIFWSL 181 Query: 186 YVPVMRSTYAAAFVIVFMLNWNNYLWPLIVLQSNDTKTITLVVSSLASAYSPEYGTVMIG 245 +P+ R V F+ +WN++LWPLIVL +T+ + +++L ++ + +M G Sbjct: 182 VLPLCRPILITLAVFTFLGSWNDFLWPLIVLTDRRLQTLPVALAALMGEHAVDTELMMSG 241 Query: 246 TILATLPTLLVFFAMQRQFVQGML-GSVK 273 L +P +++F A QR ++ G++ G VK Sbjct: 242 AALTVVPVIVLFLAAQRYYLGGLMQGGVK 270 Lambda K H 0.331 0.140 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 214 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 271 Length adjustment: 25 Effective length of query: 248 Effective length of database: 246 Effective search space: 61008 Effective search space used: 61008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory