Align ABC transporter for L-Lysine, ATPase component (characterized)
to candidate WP_010960374.1 MCA_RS05285 phosphate ABC transporter ATP-binding protein PstB
Query= reanno::pseudo5_N2C3_1:AO356_09895 (257 letters) >NCBI__GCF_000008325.1:WP_010960374.1 Length = 247 Score = 141 bits (355), Expect = 1e-38 Identities = 92/239 (38%), Positives = 134/239 (56%), Gaps = 13/239 (5%) Query: 11 RNLHKRYGQLEVLKGVSLTARDGDVISILGSSGSGKSTFLRCINLLENPNQGQILVAGEE 70 R+++ YG+ ++ VSL +VI+++G SG GKSTFLRC+N + + G + Sbjct: 3 RDVNVYYGEKHAIQNVSLDVGHNEVIALIGPSGCGKSTFLRCLNRMNDTIVGCRVTGSIR 62 Query: 71 LKLKAAKNGELVAADGKQINRLRSEIGFVFQNFNLWPHMSVLDNIIEAPR-RVLGQSKAE 129 L +G+ + G + LR+++G VFQ N +P S+ +N+ P+ L SKAE Sbjct: 63 L------DGQDIYDGGLDVVPLRAQVGMVFQKPNPFPK-SIYENVAYGPKIHGLANSKAE 115 Query: 130 AVEVAEALLAKVGIADKRH---AYPA-ELSGGQQQRAAIARTLAMQPKVILFDEPTSALD 185 E+ E+ L + G+ D+ A P LSGGQQQR IART+A+ P+VIL DEP SALD Sbjct: 116 LEEIVESSLRRAGLWDEVKDDLAKPGTSLSGGQQQRLCIARTIAVSPEVILMDEPCSALD 175 Query: 186 PEMVQEVLSVIRALAEEGRTMLLVTHEMGFARQVSSEVVFLHQGLVEEQGSPQQVFENP 244 P ++ +I L E T+ +VTH M A +VS + H G + E G QVF NP Sbjct: 176 PIATAKIEQLIDEL-RELYTIAIVTHSMQQAARVSQRTAYFHLGRLIEVGDTAQVFTNP 233 Lambda K H 0.317 0.132 0.363 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 140 Number of extensions: 6 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 247 Length adjustment: 24 Effective length of query: 233 Effective length of database: 223 Effective search space: 51959 Effective search space used: 51959 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory