GapMind for catabolism of small carbon sources

 

Protein WP_010876717.1 in Methanothermobacter thermautotrophicus str. Delta H

Annotation: NCBI__GCF_000008645.1:WP_010876717.1

Length: 312 amino acids

Source: GCF_000008645.1 in NCBI

Candidate for 26 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-alanine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 98% 119 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-isoleucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 98% 119 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-leucine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 98% 119 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-serine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 98% 119 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-threonine catabolism braF lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 98% 119 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-valine catabolism livG lo High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 33% 98% 119 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-isoleucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 34% 91% 117.9 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-leucine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 34% 91% 117.9 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-phenylalanine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 34% 91% 117.9 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-valine catabolism livF lo high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 34% 91% 117.9 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
D-lactate catabolism PGA1_c12640 lo D-lactate transporter, ATP-binding component (characterized) 31% 94% 111.7 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 94% 109.4 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 94% 109.4 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 32% 94% 109.4 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
D-cellobiose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 55% 109 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
D-glucose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 55% 109 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
lactose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 55% 109 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
D-maltose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 55% 109 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
sucrose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 55% 109 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
trehalose catabolism mglA lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 55% 109 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
D-xylose catabolism xylG lo Monosaccharide-transporting ATPase, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized) 31% 55% 109 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 31% 94% 102.1 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 31% 94% 102.1 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 89% 97.8 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 89% 97.8 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 31% 89% 97.8 ABC-type xenobiotic transporter (EC 7.6.2.2) 37% 207.6

Sequence Analysis Tools

View WP_010876717.1 at NCBI

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MDHIIETEDIKKKYDEFLAVKGVNLRVPEGSIYGVLGPNGAGKTTLISMLCTILRPTGGR
GTVNGYDIVRDARKVRESIGIVFQSRALDDILTGREHLEMHAALYGVPRDVRDRRIEEVL
ELIALGDKADEYVKTYSGGMKRRLEIGRGLIHHPRVLFLDEPTLGLDPQTRESIWRYIEK
LNREEDVTVLLTTHYMEEADKLCDEVAIMSHGEIIKADSPGNLKRELGADTITVRVDRAR
GFHEILEKQDYVKEAYLMDDEVKVLVERGENLVPEIVNLAARNNYYVRAVELEHPTLEDV
FIKYTGRGISEA

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory