Align High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate WP_010877312.1 MTH_RS08165 ATP-binding cassette domain-containing protein
Query= TCDB::P21630 (233 letters) >NCBI__GCF_000008645.1:WP_010877312.1 Length = 311 Score = 102 bits (254), Expect = 9e-27 Identities = 69/206 (33%), Positives = 118/206 (57%), Gaps = 7/206 (3%) Query: 16 ALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTI-M 74 AL ++++V++GE V +IG NGAGKSTL + L G + A+G + +GE + I + Sbjct: 17 ALRGINMKVERGERVAVIGPNGAGKSTLFLHLNGILKPAAGEVIIDGERVDYSKDELIKI 76 Query: 75 RKSIAVVPEGR--RVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRL-KERYEQRA 131 R+ + +V + ++FS TV E++A G + +V+ ++V E ++ YE RA Sbjct: 77 RQKVGIVFQNPDDQLFSP-TVREDVAFGPMNLGLPEDEVE-ERVAESLEKVGMSGYENRA 134 Query: 132 GT-MSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVE 190 +SGGE++ +AI L KP++++LDEP+ GL P I I+ +L REG+TV + Sbjct: 135 PHHLSGGEKKRVAIAGILAMKPEIMVLDEPTTGLDPETADGIIRILLELSREGITVMISS 194 Query: 191 QNANQALKLADRAYVLENGRIVMHDT 216 + + A+R +VL +G ++ T Sbjct: 195 HDVEIISQFAERVFVLNSGELIAEGT 220 Lambda K H 0.318 0.136 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 176 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 233 Length of database: 311 Length adjustment: 25 Effective length of query: 208 Effective length of database: 286 Effective search space: 59488 Effective search space used: 59488 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory