Align glucose transporter, ATPase component (characterized)
to candidate WP_010876982.1 MTH_RS06550 ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF3641 (260 letters) >NCBI__GCF_000008645.1:WP_010876982.1 Length = 319 Score = 109 bits (272), Expect = 8e-29 Identities = 74/236 (31%), Positives = 123/236 (52%), Gaps = 15/236 (6%) Query: 15 LVEMKDISISFGGIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVLSGAYQMDAGEIRV 74 ++E++ +S SFG I+A+D++S + GE++G++GHNGAGK+T I++++G D+G +RV Sbjct: 18 MIEVESVSKSFGRIRALDNLSFSVAEGELMGIIGHNGAGKTTAIRIIAGILHPDSGTVRV 77 Query: 75 NGDKVEITNPRDARSHNIETIYQTLALADNLDAASNL-FLGRELVTPFGLVDDSAMEAEC 133 G V +P +S I + + L + A L + G P ++DD E Sbjct: 78 GGHDV-TEDPLSVKS-MIGYLPEEPNLYERFRAGDLLRYFGELYGVPRDVLDDRIAE--- 132 Query: 134 RKIMNRLNPNFQKFSEPVSALSGGQRQSVAIARAVYFNAKILIMDEPTAALGPHETQMVA 193 + L + +P++ S G RQ + IARA+ + I+I DEPT L P + Sbjct: 133 ---LLELVGMTDRAMDPINTFSKGLRQRIGIARALIHDPPIIIFDEPTMGLDPATAFSIR 189 Query: 194 ELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLVGTVDIDDVTDDDLLSMI 249 E I+ LK + L H + LCDR +++ G++ +D T D+L S I Sbjct: 190 EFIRDLKGSKT-MILCTHYMEEAEYLCDRVAIINQGRI-----LDIGTPDELKSKI 239 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 319 Length adjustment: 26 Effective length of query: 234 Effective length of database: 293 Effective search space: 68562 Effective search space used: 68562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory