Align Leucine/isoleucine/valine ABC transporter,permease component (characterized, see rationale)
to candidate WP_011652368.1 RL_RS14690 branched-chain amino acid ABC transporter permease
Query= uniprot:G8ALI9 (505 letters) >NCBI__GCF_000009265.1:WP_011652368.1 Length = 337 Score = 155 bits (392), Expect = 2e-42 Identities = 98/288 (34%), Positives = 152/288 (52%), Gaps = 13/288 (4%) Query: 180 LTYIMLGWGLNIVVGLAGLLDLGYVAFYAVGAYSYALLAHYFGFSFWVCLPLAGFLAAMS 239 L Y + GLN+ +G AG + L +F AVGAY AL+ G + + +P++ + Sbjct: 37 LIYTIAAMGLNLTLGYAGQISLAQASFMAVGAYITALMTMN-GIHWLIAMPVSVAACFVI 95 Query: 240 GVLLGFPVLRLRGDYFAIVTLGFGEIIRIILINWYQFTGGPNGISGIPRPSFFGIADFTR 299 G+L+GFP LR++G + A VTL F ++ ++L N TGG G S +PRP F+ + Sbjct: 96 GLLVGFPALRVKGHFLAFVTLAFNTLLVLVLRNEDWLTGGSYGKSNMPRPDFWVFDTGMK 155 Query: 300 TPAEGTAAFHEMFGLEFSPLHRIIFLYYLILVLALVVNLFTMRVRKLPLGRAWEALREDD 359 + PL +YYL LV+ ++ L + + P GRA++ LRE+ Sbjct: 156 STVLSI------------PLTSNQKMYYLCLVVFVIFALLMYGLVRSPWGRAFKGLRENP 203 Query: 360 IACASLGINRTNMKLAAFAIAAMFGGFAGSFFATRQGFISPESFTFIESAIILAIVVLGG 419 I SLG++ + L AFAI + GG AGS + +I P SF S IL +VV+GG Sbjct: 204 IRAESLGLDIRRITLLAFAIGSAAGGLAGSLVSPVVQYIEPNSFALSFSLKILLMVVVGG 263 Query: 420 MGSQIGVVVAAFLVIGLPEAFRELADYRMLAFGMGMVLIMLWRPRGLL 467 G G ++ A +VI LPE R Y ++ + ++L+M++ P GL+ Sbjct: 264 SGYFFGPMLGAAVVILLPEFLRFTEGYYLIIYSALVILLMVFSPSGLM 311 Lambda K H 0.329 0.144 0.438 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 429 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 505 Length of database: 337 Length adjustment: 31 Effective length of query: 474 Effective length of database: 306 Effective search space: 145044 Effective search space used: 145044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory