Align ABC-type permease for basic amino acids and glutamine (characterized, see rationale)
to candidate WP_011654261.1 RL_RS41060 amino acid ABC transporter permease/ATP-binding protein
Query= uniprot:Q31RP0 (377 letters) >NCBI__GCF_000009265.1:WP_011654261.1 Length = 591 Score = 99.4 bits (246), Expect = 2e-25 Identities = 65/202 (32%), Positives = 105/202 (51%), Gaps = 23/202 (11%) Query: 195 LAQRQRSPR------DWRWLYGAIAVVTVLMLLTQLSWPQQLQPGQIRGGL--------- 239 LA+ RSP + WL +I V+ +L++L L + + I+ G+ Sbjct: 100 LARVSRSPLLSGLSWGYIWLLRSIPVIVLLLILNNLGYLYET----IKIGIPFTDTVFLD 155 Query: 240 ----RLSLEFTALLLGLVAYTGAFITEIIRGGILSVPAGQWEAAAALGLTRSQTLWQIVV 295 +L F A LGL AF EI+RGGILSV GQ EAAAALGL R + ++IV+ Sbjct: 156 YPTVQLLTPFAAAFLGLTLNQSAFFAEIVRGGILSVDHGQLEAAAALGLPRRRQAFRIVL 215 Query: 296 PQALRVIVPSLNSQYVGFAKNSSLAIAVGYPDLYATAQTTLNQTGRPVEVFLILMLTYLA 355 PQA+R I+P+ ++ +G AK++S+ + P+L+ T Q + + + ++ + YL Sbjct: 216 PQAMRSILPTGFNELIGLAKSTSMVYVLALPELFYTVQVIYRRNLEVIPLLMVATVWYLI 275 Query: 356 INAVISAGMNGLQQRLQRWGVR 377 I V+S +++ + VR Sbjct: 276 IMTVLSIAQRYIERYFSKGAVR 297 Score = 39.3 bits (90), Expect = 3e-07 Identities = 19/63 (30%), Positives = 39/63 (61%) Query: 78 YARALVVGLVNSLRVIAIGLILTTVIGTLAGVAAFSENWLLRQLSRGYVAVVRNTPLLLQ 137 +A ++VGL +L + + I +++GT +A S + LL LS GY+ ++R+ P+++ Sbjct: 69 FAEPVLVGLGRTLLLTVLAAISGSILGTALALARVSRSPLLSGLSWGYIWLLRSIPVIVL 128 Query: 138 LIV 140 L++ Sbjct: 129 LLI 131 Lambda K H 0.326 0.140 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 23 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 2 Length of query: 377 Length of database: 591 Length adjustment: 33 Effective length of query: 344 Effective length of database: 558 Effective search space: 191952 Effective search space used: 191952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory