Align BztC, component of Glutamate/glutamine/aspartate/asparagine porter (characterized)
to candidate WP_011654450.1 RL_RS29540 amino acid ABC transporter permease
Query= TCDB::Q52665 (434 letters) >NCBI__GCF_000009265.1:WP_011654450.1 Length = 252 Score = 108 bits (269), Expect = 2e-28 Identities = 72/223 (32%), Positives = 120/223 (53%), Gaps = 11/223 (4%) Query: 212 LPLALPEVDSDQFGGFLLALVIGVTAIVVSLPLGILLALGRQSDMLIVKSLSVGIIEFVR 271 L L + + + GG L++ +I ++ P+ IL AL R S +++ ++ F R Sbjct: 14 LLLLIGQYPNGPLGGLANTLILSALSIALAFPVSILFALARLSRSPLLRWPVTALVYFTR 73 Query: 272 GVPLITLLFTASLLLQYFLPPG-TNFDLILRVVILVTL--FAAAYIAEVIRGGLAALPRG 328 GVPL+ L+ L YFL P T D+ V +L TL + +A+++EV+R G+ AL G Sbjct: 74 GVPLLMLI-----LWSYFLVPLLTGADVPSFVTMLTTLVVYQSAFLSEVVRAGIVALGPG 128 Query: 329 QYEAADALGLDYWQAQRLIIMPQALKISIPGIVSSFIGLFKDTTLVAFVGLFDPLKGISN 388 Q +A ALG Y A R II+PQAL IP I+S+F+ KDTTL + + D S Sbjct: 129 QMDAGRALGHSYIGAMRFIILPQALYNMIPSIISTFVSTIKDTTLGYVINVPDLTFAASQ 188 Query: 389 VVRSDMAWKGTYWEPYIFVALIFFLFNFSMSRYSMYLERKLKR 431 V + ++ ++ +A+++F ++++ ++ LER + R Sbjct: 189 VNNQLLTQP---FQVFLILAIVYFAICWTLTYFANRLERSITR 228 Lambda K H 0.329 0.143 0.457 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 279 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 434 Length of database: 252 Length adjustment: 28 Effective length of query: 406 Effective length of database: 224 Effective search space: 90944 Effective search space used: 90944 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory