Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate WP_011649487.1 RL_RS41085 amino acid ABC transporter permease/ATP-binding protein
Query= SwissProt::P0AER5 (224 letters) >NCBI__GCF_000009265.1:WP_011649487.1 Length = 511 Score = 118 bits (296), Expect = 2e-31 Identities = 76/225 (33%), Positives = 120/225 (53%), Gaps = 15/225 (6%) Query: 5 DWSSIVPSLPYLLD-GLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNVF 63 DW ++ LP ++ GL TL + + V+G++ G LAVM +S + A+ Y ++F Sbjct: 13 DWDAMAEVLPSMISVGLKNTLILAAASTVLGVIIGMALAVMGISQSRWLRLPARIYTDIF 72 Query: 64 RSIPLVMVLLWFYLIVPGFLQ---NVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGI 120 R +P ++ +L +I GF + + G SP ++A S+ AY EI R+GI Sbjct: 73 RGLPAIVTIL---IIGQGFARIGREIFGPSP-----FPLGILALSLIAGAYIGEIFRSGI 124 Query: 121 QSISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADF 180 QS+ RGQ A AL M+H Q M+LI++PQ R ++P L+ Q I +D+SLVY L L Sbjct: 125 QSVERGQMEACRALSMSHGQGMRLIVIPQGIRRVLPALVNQFIGNVKDSSLVYFLGLLAS 184 Query: 181 FRTASTIGERDGT---QVEMILFAGFVYFVISLSASLLVSYLKRR 222 R +G+ + +L AG Y VI++ + V+Y+ R Sbjct: 185 EREIFRVGQDQAVVTGNLSPLLLAGVFYLVITVPLTHFVNYIDAR 229 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 511 Length adjustment: 28 Effective length of query: 196 Effective length of database: 483 Effective search space: 94668 Effective search space used: 94668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory