Align aerobic C4-dicarboxylate transport protein (characterized)
to candidate WP_011652906.1 RL_RS17640 dicarboxylate/amino acid:cation symporter
Query= CharProtDB::CH_014038 (428 letters) >NCBI__GCF_000009265.1:WP_011652906.1 Length = 444 Score = 524 bits (1350), Expect = e-153 Identities = 268/426 (62%), Positives = 334/426 (78%), Gaps = 5/426 (1%) Query: 2 KTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTGI 61 K + LY QVL AIA GILLGHFYPE G Q+KPLGD F+KL+KMIIAPVIF TV TGI Sbjct: 15 KKPFYTHLYVQVLAAIAAGILLGHFYPEFGTQLKPLGDAFIKLVKMIIAPVIFLTVATGI 74 Query: 62 AGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVYA 121 AGM ++ VGR A+LYF ST+ALIIGLI+ NVVQPGAGMN+DPA+LD AVA YA Sbjct: 75 AGMSDLQKVGRVAGKAMLYFLTFSTLALIIGLIVANVVQPGAGMNIDPASLDPAAVAGYA 134 Query: 122 DQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIESF 181 +A +Q IV F+ ++IP +++GAFA G+ILQVL F+VLFG AL +G K + + N + + Sbjct: 135 AKAHEQSIVGFLTNIIPTTIVGAFADGDILQVLFFSVLFGIALAMVGEKSEPVVNFLNAL 194 Query: 182 SQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGSI 241 + +F ++ ++M+ APIGAFGAMAFTIGKYGVG++ L LI FYIT +LFV++VLG++ Sbjct: 195 TAPVFKLVAILMKAAPIGAFGAMAFTIGKYGVGSIANLAMLIGTFYITSLLFVLVVLGAV 254 Query: 242 AKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSFN 301 A+ GFSI +RYI+EELL+VLGTSSSE+ALP +++KMEK GC++SVVGLVIPTGYSFN Sbjct: 255 ARYNGFSIVALLRYIKEELLLVLGTSSSEAALPGLMNKMEKAGCKRSVVGLVIPTGYSFN 314 Query: 302 LDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSAV 361 LDGT+IY+T+AA+FIAQAT Q+ QI LL+V +LSSKGAAG+TG+GFI LAATLS V Sbjct: 315 LDGTNIYMTLAALFIAQATGIQLSWGDQILLLLVAMLSSKGAAGITGAGFITLAATLSVV 374 Query: 362 GHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLNNRAPDG 421 +PVAG+ALILGIDRFMSE RALTNLVGN VATIVVA+W ELD +L L G Sbjct: 375 PSVPVAGMALILGIDRFMSECRALTNLVGNAVATIVVARWENELDTAQLAAALG-----G 429 Query: 422 KTHELS 427 +T E++ Sbjct: 430 QTGEMA 435 Lambda K H 0.327 0.142 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 646 Number of extensions: 28 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 428 Length of database: 444 Length adjustment: 32 Effective length of query: 396 Effective length of database: 412 Effective search space: 163152 Effective search space used: 163152 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory