Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate WP_011648876.1 RL_RS33345 amino acid ABC transporter ATP-binding protein
Query= reanno::pseudo6_N2E2:Pf6N2E2_2050 (263 letters) >NCBI__GCF_000009265.1:WP_011648876.1 Length = 241 Score = 254 bits (649), Expect = 1e-72 Identities = 132/246 (53%), Positives = 173/246 (70%), Gaps = 10/246 (4%) Query: 13 LLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIML 72 L++I +RK +G EVLKG++L ++ G V+ +IG SGSGK+TLLRC+N LE G I + Sbjct: 3 LIEITEVRKSFGTTEVLKGINLDVEAGEVIAIIGKSGSGKSTLLRCINGLETITDGSISV 62 Query: 73 DGESIGYDDIDGKRVRHPEKVIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLPK 132 G + D++ K +R GM FQQFNLFPHLT NV L VKK PK Sbjct: 63 AGAQLLDDEVHLKALR----------LKVGMIFQQFNLFPHLTVGGNVMLSQTVVKKTPK 112 Query: 133 DEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPE 192 EA A A K LERVGL R D +P +LSGGQQQRVAIARA+AM P+ +L DE+TSALDPE Sbjct: 113 AEAEATARKMLERVGLGHRFDAYPDELSGGQQQRVAIARALAMQPTALLCDEITSALDPE 172 Query: 193 LVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSP 252 LV EVL V++ LA +GMT+L+VTHEM+FA +V ++++FM+QGR+ E GPP+E+F +PQ+ Sbjct: 173 LVAEVLAVVRELAAEGMTLLMVTHEMKFARDVCNRVIFMHQGRVHEAGPPEEVFAKPQTA 232 Query: 253 RLAEFL 258 L +FL Sbjct: 233 ELKQFL 238 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 241 Length adjustment: 24 Effective length of query: 239 Effective length of database: 217 Effective search space: 51863 Effective search space used: 51863 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory