Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_011649208.1 RL_RS35130 urea ABC transporter permease subunit UrtB
Query= uniprot:Q1MCU0 (300 letters) >NCBI__GCF_000009265.1:WP_011649208.1 Length = 297 Score = 141 bits (355), Expect = 2e-38 Identities = 95/299 (31%), Positives = 152/299 (50%), Gaps = 27/299 (9%) Query: 8 LLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFAGLPVA 67 L GL+LGSI LVA+G + YG +G+IN AHG++ M+G + A++ +G+ + Sbjct: 5 LFIGLSLGSILLLVALGLAITYGAMGVINMAHGEMVMIGAYVAVL---------SGIWLK 55 Query: 68 VLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFRLAPLITAIGMSITLSNFIQVT----- 122 LL+ + +A ++T+L IERV R L G L L+ G++I L +++ Sbjct: 56 ASLLLAIPLAFVVTALLGLLIERVVVRRLYGRL-LDTLLATWGIAILLQQAVRLEFGLSF 114 Query: 123 ---------QGPRNKPIPPMVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALG 173 G +N P+P + ++ ++ + II +TA L W+I+ RTA G Sbjct: 115 FGIHVEGLGAGLQNVPVPAYLQGTFRLAGADINAYRTFIIAVTAALTLATWFILYRTAAG 174 Query: 174 RAQRATEQDRKMAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGVASFND-GFTPGV 232 RA ++ KMAA G++V + ++TF G+ LA VAG M + V F D G T V Sbjct: 175 MQVRAIIRNPKMAAACGIDVKRVNAMTFAFGSGLAGVAGVMMSGFKTV--FPDMGTTMVV 232 Query: 233 KAFTAAVLGGIGSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGI 291 F V GG+GSL G + L+G I +L + F ++ V++ KP+G+ Sbjct: 233 DGFMVVVTGGVGSLFGTILSSGLLGEINALVAIGTNDILARAVVFGVVILVILVKPSGL 291 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 246 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 297 Length adjustment: 27 Effective length of query: 273 Effective length of database: 270 Effective search space: 73710 Effective search space used: 73710 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory