Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate WP_032984735.1 RL_RS25315 ABC transporter ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >NCBI__GCF_000009265.1:WP_032984735.1 Length = 243 Score = 174 bits (441), Expect = 1e-48 Identities = 97/237 (40%), Positives = 143/237 (60%), Gaps = 5/237 (2%) Query: 14 VNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVFE-- 71 V + YG ++ L G+ + +GE V L+G NG GKSTLM + G + GS+ E Sbjct: 7 VRDLHAGYGTVQVLHGLSIEAREGETVVLLGTNGNGKSTLMKCLIGDVRPTQGSITLELD 66 Query: 72 --GRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQMGAGLDNLKH-FAEDVEKIFT 128 D+T + T +I I+ PEGRR+FP++TV ENL +GA + A ++E + Sbjct: 67 GQAIDLTHLGTDQIVEYGISIVPEGRRLFPQLTVEENLLLGAYRKAARSKIAANLEFCYG 126 Query: 129 LFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIRK 188 FP LKER Q G++SGG+QQML++GRA+M+ P++LL+DEPS+GLAP++V I + Sbjct: 127 AFPILKERRRQLSGSMSGGQQQMLALGRAIMSSPRILLVDEPSVGLAPIMVSQAIAKIGE 186 Query: 189 LNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYLEGG 245 L E GLTV + EQN A+R++ R YV+V+G+V S L + E+ + GG Sbjct: 187 LKEQFGLTVVMAEQNFQEAMRIADRGYVLVHGEVAFSAETAAELRDSELISQLYLGG 243 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 162 Number of extensions: 4 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 243 Length adjustment: 24 Effective length of query: 223 Effective length of database: 219 Effective search space: 48837 Effective search space used: 48837 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory